Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fractalkine/CX3CL1, Human

Fractalkine/CX3CL1 Protein, Human is found to be associated with inflammatory diseases such as rheumatoid arthritis (RA), rheumatoid vasculitis (RV) .

Product Specifications

Product Name Alternative

Fractalkine/CX3CL1 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fractalkine-cx3cl1-protein-human.html

Purity

97.0

Smiles

QHHGVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQWVKDAMQHLDRQAAALTRNG

Molecular Formula

6376 (Gene_ID) P78423 (Q25-G100) (Accession)

Molecular Weight

Approximately 9 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Jones BA, et al. Fractalkine/CX3CL1: a potential new target for inflammatory diseases. Mol Interv. 2010 Oct;10 (5) :263-70.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

AVEN Rabbit Monoclonal Antibody
E10G21102 100 µL

AVEN Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Sun1 (NM_001007147) Rat Tagged Lenti ORF Clone
RR207257L3 10 µg

Sun1 (NM_001007147) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rabbit Polyclonal Carboxypeptidase M Antibody
NBP1-87403 0.1 mL

Rabbit Polyclonal Carboxypeptidase M Antibody

Sign In for Pricing
View Details
UBXN8, NT (UBXN8, D8S2298E, REP8, UBXD6, UBX domain-containing protein 8, Reproduction 8 protein, UBX domain-containing protein 6)
MBS6007372-01 0.2 mL

UBXN8, NT (UBXN8, D8S2298E, REP8, UBXD6, UBX domain-containing protein 8, Reproduction 8 protein, UBX domain-containing protein 6)

Sign In for Pricing
View Details
UBXN8, NT (UBXN8, D8S2298E, REP8, UBXD6, UBX domain-containing protein 8, Reproduction 8 protein, UBX domain-containing protein 6)
MBS6007372-02 5x 0.2 mL

UBXN8, NT (UBXN8, D8S2298E, REP8, UBXD6, UBX domain-containing protein 8, Reproduction 8 protein, UBX domain-containing protein 6)

Sign In for Pricing
View Details
JunB/AP-1 Recombinant Protein Antigen
NBP1-89544PEP 0.1 mL

JunB/AP-1 Recombinant Protein Antigen

Sign In for Pricing
View Details