Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fractalkine/CX3CL1, Human

Fractalkine/CX3CL1 Protein, Human is found to be associated with inflammatory diseases such as rheumatoid arthritis (RA), rheumatoid vasculitis (RV) .

Product Specifications

Product Name Alternative

Fractalkine/CX3CL1 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fractalkine-cx3cl1-protein-human.html

Purity

97.0

Smiles

QHHGVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQWVKDAMQHLDRQAAALTRNG

Molecular Formula

6376 (Gene_ID) P78423 (Q25-G100) (Accession)

Molecular Weight

Approximately 9 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Jones BA, et al. Fractalkine/CX3CL1: a potential new target for inflammatory diseases. Mol Interv. 2010 Oct;10 (5) :263-70.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPARd, Control Peptide (Peroxisome Proliferator Activated Receptor, delta)
P5505-04A 1 mg

PPARd, Control Peptide (Peroxisome Proliferator Activated Receptor, delta)

Sign In for Pricing
View Details
PCMV-HA-MYD88
BZ15067 1 Vial

PCMV-HA-MYD88

Sign In for Pricing
View Details
SPP1 Protein Vector (Mouse) (pPB-C-His)
PV233614 500 ng

SPP1 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Gpr17 (NM_001071777) Rat Tagged Lenti ORF Clone
RR212255L3 10 µg

Gpr17 (NM_001071777) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
6bK (TFA)
HY-110197-01 500 µg

6bK (TFA)

Sign In for Pricing
View Details
6bK (TFA)
HY-110197-02 1 mg

6bK (TFA)

Sign In for Pricing
View Details