Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LIF, Mouse

LIF Protein, Mouse is a lymphoid factor involved in various neural and inflammatory processes such as the acute-phase reaction, tissue damage, and infection.

Product Specifications

Product Name Alternative

LIF Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lif-protein-mouse.html

Purity

98.0

Smiles

SPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFPNNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNPTAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQRKKLGCQLLGTYKQVISVVVQAFSPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPF

Molecular Formula

16878 (Gene_ID) P09056 (S24-F203) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Metcalf D, et al. Effects of injected leukemia inhibitory factor on hematopoietic and other tissues in mice. Blood. 1990 Jul 1;76 (1) :50-6.|[2]Banner LR, et al. Leukemia inhibitory factor is an anti-inflammatory and analgesic cytokine. J Neurosci. 1998 Jul 15;18 (14) :5456-62.|[3]Gearing DP, et al. Leukemia inhibitory factor receptor is structurally related to the IL-6 signal transducer, gp130. EMBO J. 1991 Oct;10 (10) :2839-48.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CALU Knockout NCI-H1975 Polyclonal Cells
ARG41913 1 Million

CALU Knockout NCI-H1975 Polyclonal Cells

Sign In for Pricing
View Details
ZIP1 Conjugated Antibody
orb1612804 100 µL

ZIP1 Conjugated Antibody

Sign In for Pricing
View Details
Recombinant Human HERV-K_8p23.1 provirus ancestral Pol protein , partial
MBS1104781-01 0.02 mg (E-Coli)

Recombinant Human HERV-K_8p23.1 provirus ancestral Pol protein , partial

Sign In for Pricing
View Details
Recombinant Human HERV-K_8p23.1 provirus ancestral Pol protein , partial
MBS1104781-02 0.1 mg (E-Coli)

Recombinant Human HERV-K_8p23.1 provirus ancestral Pol protein , partial

Sign In for Pricing
View Details
Recombinant Human HERV-K_8p23.1 provirus ancestral Pol protein , partial
MBS1104781-03 0.02 mg (Yeast)

Recombinant Human HERV-K_8p23.1 provirus ancestral Pol protein , partial

Sign In for Pricing
View Details
Recombinant Human HERV-K_8p23.1 provirus ancestral Pol protein , partial
MBS1104781-04 0.1 mg (Yeast)

Recombinant Human HERV-K_8p23.1 provirus ancestral Pol protein , partial

Sign In for Pricing
View Details