Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FABP1/L-FABP, Human (His, solution)

FABP1/L-FABP Protein is crucial for lipoprotein-mediated cholesterol uptake in hepatocytes, specifically binding cholesterol, free fatty acids, coenzyme A derivatives, and bilirubin within the cytoplasm. It may also participate in intracellular lipid transport, sharing similarities with other proteins. FABP1/L-FABP Protein, Human (His, solution) is the recombinant human-derived FABP1/L-FABP protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

FABP1/L-FABP Protein, Human (His, solution), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fabp1-l-fabp-protein-human-his-solution.html

Purity

98.0

Smiles

MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI

Molecular Formula

2168 (Gene_ID) P07148 (M1-I127) (Accession)

Molecular Weight

Approximately 16.0 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Photomedin-1 Polyclonal Antibody
ABP53997-01 30 µL

Photomedin-1 Polyclonal Antibody

Sign In for Pricing
View Details
Photomedin-1 Polyclonal Antibody
ABP53997-02 100 µL

Photomedin-1 Polyclonal Antibody

Sign In for Pricing
View Details
Photomedin-1 Polyclonal Antibody
ABP53997-03 200 µL

Photomedin-1 Polyclonal Antibody

Sign In for Pricing
View Details
Nuclear Factor of Activated T-Cells, Cytoplasmic 1 (NFATC1) BioAssayTM ELISA Kit (Mouse) discontinued
027191-01 48 Tests

Nuclear Factor of Activated T-Cells, Cytoplasmic 1 (NFATC1) BioAssayTM ELISA Kit (Mouse) discontinued

Sign In for Pricing
View Details
Nuclear Factor of Activated T-Cells, Cytoplasmic 1 (NFATC1) BioAssayTM ELISA Kit (Mouse) discontinued
027191-02 96 Tests

Nuclear Factor of Activated T-Cells, Cytoplasmic 1 (NFATC1) BioAssayTM ELISA Kit (Mouse) discontinued

Sign In for Pricing
View Details
H-Trp-Gly-Gly-Tyr-OH
H-5105.0500 500.0mg

H-Trp-Gly-Gly-Tyr-OH

Sign In for Pricing
View Details