Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FABP1/L-FABP, Human (His, solution)

FABP1/L-FABP Protein is crucial for lipoprotein-mediated cholesterol uptake in hepatocytes, specifically binding cholesterol, free fatty acids, coenzyme A derivatives, and bilirubin within the cytoplasm. It may also participate in intracellular lipid transport, sharing similarities with other proteins. FABP1/L-FABP Protein, Human (His, solution) is the recombinant human-derived FABP1/L-FABP protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

FABP1/L-FABP Protein, Human (His, solution), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fabp1-l-fabp-protein-human-his-solution.html

Purity

98.0

Smiles

MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI

Molecular Formula

2168 (Gene_ID) P07148 (M1-I127) (Accession)

Molecular Weight

Approximately 16.0 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GAGE2A Antibody - C-terminal region
ARP64957_P050-25UL 25 µL

GAGE2A Antibody - C-terminal region

Sign In for Pricing
View Details
ATF2 Peptide
AF6176-BP 1 mg

ATF2 Peptide

Sign In for Pricing
View Details
Lentiviral human C16orf58 shRNA (UAS) - Lentiviral human C16orf58 shRNA (UAS) plasmid
GTR15078271 1 Vial

Lentiviral human C16orf58 shRNA (UAS) - Lentiviral human C16orf58 shRNA (UAS) plasmid

Sign In for Pricing
View Details
UPRT Mouse Monoclonal Antibody [Clone ID: LBI2D1]
AMM14018VCF 100 µg

UPRT Mouse Monoclonal Antibody [Clone ID: LBI2D1]

Sign In for Pricing
View Details
ANT 1 (PRPF6) (NM_012469) Human Recombinant Protein
TP300527M 100 µg

ANT 1 (PRPF6) (NM_012469) Human Recombinant Protein

Sign In for Pricing
View Details
Otogl sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K3154107 1.0 µg DNA

Otogl sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details