Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MMP-9, Mouse (HEK293, C-His)

The MMP-9 protein is a matrix metalloproteinase that is critical for local extracellular matrix proteolysis and leukocyte migration.It is suggested that it may be involved in bone osteoclastic resorption.MMP-9 Protein, Mouse (HEK293, C-His) is the recombinant mouse-derived MMP-9 protein, expressed by HEK293 , with C-10*His labeled tag.

Product Specifications

Product Name Alternative

MMP-9 Protein, Mouse (HEK293, C-His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mmp-9-protein-mouse-hek293-c-his.html

Purity

95.0

Smiles

APYQRQPTFVVFPKDLKTSNLTDTQLAEAYLYRYGYTRAAQMMGEKQSLRPALLMLQKQLSLPQTGELDSQTLKAIRTPRCGVPDVGRFQTFKGLKWDHHNITYWIQNYSEDLPRDMIDDAFARAFAVWGEVAPLTFTRVYGPEADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGAGVQGDAHFDDDELWSLGKGVVIPTYYGNSNGAPCHFPFTFEGRSYSACTTDGRNDGTPWCSTTADYDKDGKFGFCPSERLYTEHGNGEGKPCVFPFIFEGRSYSACTTKGRSDGYRWCATTANYDQDKLYGFCPTRVDATVVGGNSAGELCVFPFVFLGKQYSSCTSDGRRDGRLWCATTSNFDTDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMYPLYSYLEGFPLNKDDIDGIQYLYGRGSKPDPRPPATTTTEPQPTAPPTMCPTIPPTAYPTVGPTVGPTGAPSPGPTSSPSPGPTGAPSPGPTAPPTAGSSEASTESLSPADNPCNVDVFDAIAEIQGALHFFKDGWYWKFLNHRGSPLQGPFLTARTWPALPATLDSAFEDPQTKRVFFFSGRQMWVYTGKTVLGPRSLDKLGLGPEVTHVSGLLPRRLGKALLFSKGRVWRFDLKSQKVDPQSVIRVDKEFSGVPWNSHDIFQYQDKAYFCHGKFFWRVSFQNEVNKVDHEVNQVDDVGYVTYDLLQCP

Molecular Formula

17395 (Gene_ID) P41245 (A20-P730) (Accession)

Molecular Weight

Approximately 93.64 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Vmn2r42 activation kit by CRISPRa
GA204575 1 Kit

Mouse Vmn2r42 activation kit by CRISPRa

Sign In for Pricing
View Details
Anti-eIF4E Rabbit pAb
GB11565-100 100 μL

Anti-eIF4E Rabbit pAb

Sign In for Pricing
View Details
Rabbit Polyclonal ANKRD50 Antibody [DyLight 680]
NBP1-50032FR 0.1 mL

Rabbit Polyclonal ANKRD50 Antibody [DyLight 680]

Sign In for Pricing
View Details
Ufc1 (NM_001003709) Rat Tagged ORF Clone
RR208640 10 µg

Ufc1 (NM_001003709) Rat Tagged ORF Clone

Sign In for Pricing
View Details
Mouse Neuropilin and tolloid-like protein 1, NETO1 ELISA Kit
MBS9333064-01 48 Well

Mouse Neuropilin and tolloid-like protein 1, NETO1 ELISA Kit

Sign In for Pricing
View Details
Mouse Neuropilin and tolloid-like protein 1, NETO1 ELISA Kit
MBS9333064-02 96 Well

Mouse Neuropilin and tolloid-like protein 1, NETO1 ELISA Kit

Sign In for Pricing
View Details