Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MMP-9, Mouse (HEK293, C-His)

The MMP-9 protein is a matrix metalloproteinase that is critical for local extracellular matrix proteolysis and leukocyte migration.It is suggested that it may be involved in bone osteoclastic resorption.MMP-9 Protein, Mouse (HEK293, C-His) is the recombinant mouse-derived MMP-9 protein, expressed by HEK293 , with C-10*His labeled tag.

Product Specifications

Product Name Alternative

MMP-9 Protein, Mouse (HEK293, C-His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mmp-9-protein-mouse-hek293-c-his.html

Purity

95.0

Smiles

APYQRQPTFVVFPKDLKTSNLTDTQLAEAYLYRYGYTRAAQMMGEKQSLRPALLMLQKQLSLPQTGELDSQTLKAIRTPRCGVPDVGRFQTFKGLKWDHHNITYWIQNYSEDLPRDMIDDAFARAFAVWGEVAPLTFTRVYGPEADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGAGVQGDAHFDDDELWSLGKGVVIPTYYGNSNGAPCHFPFTFEGRSYSACTTDGRNDGTPWCSTTADYDKDGKFGFCPSERLYTEHGNGEGKPCVFPFIFEGRSYSACTTKGRSDGYRWCATTANYDQDKLYGFCPTRVDATVVGGNSAGELCVFPFVFLGKQYSSCTSDGRRDGRLWCATTSNFDTDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMYPLYSYLEGFPLNKDDIDGIQYLYGRGSKPDPRPPATTTTEPQPTAPPTMCPTIPPTAYPTVGPTVGPTGAPSPGPTSSPSPGPTGAPSPGPTAPPTAGSSEASTESLSPADNPCNVDVFDAIAEIQGALHFFKDGWYWKFLNHRGSPLQGPFLTARTWPALPATLDSAFEDPQTKRVFFFSGRQMWVYTGKTVLGPRSLDKLGLGPEVTHVSGLLPRRLGKALLFSKGRVWRFDLKSQKVDPQSVIRVDKEFSGVPWNSHDIFQYQDKAYFCHGKFFWRVSFQNEVNKVDHEVNQVDDVGYVTYDLLQCP

Molecular Formula

17395 (Gene_ID) P41245 (A20-P730) (Accession)

Molecular Weight

Approximately 93.64 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CREB1 (Cyclic AMP Response Element Binding Protein 1) ELISA Kit
RE2982H-01 48 Tests

Human CREB1 (Cyclic AMP Response Element Binding Protein 1) ELISA Kit

Sign In for Pricing
View Details
Human CREB1 (Cyclic AMP Response Element Binding Protein 1) ELISA Kit
RE2982H-02 96 Tests

Human CREB1 (Cyclic AMP Response Element Binding Protein 1) ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal APEH Antibody [DyLight 405]
NBP2-99357V 0.1 mL

Rabbit Polyclonal APEH Antibody [DyLight 405]

Sign In for Pricing
View Details
RPL13P11 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV776692 1.0 µg DNA

RPL13P11 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
SMYD4 (NM_052928) Human Tagged Lenti ORF Clone
RC207305L4 10 µg

SMYD4 (NM_052928) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rabbit Polyclonal Uroplakin Ib Antibody [PerCP]
NBP2-81768PCP 0.1 mL

Rabbit Polyclonal Uroplakin Ib Antibody [PerCP]

Sign In for Pricing
View Details