Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MMP-9, Mouse (HEK293, C-His)

The MMP-9 protein is a matrix metalloproteinase that is critical for local extracellular matrix proteolysis and leukocyte migration.It is suggested that it may be involved in bone osteoclastic resorption.MMP-9 Protein, Mouse (HEK293, C-His) is the recombinant mouse-derived MMP-9 protein, expressed by HEK293 , with C-10*His labeled tag.

Product Specifications

Product Name Alternative

MMP-9 Protein, Mouse (HEK293, C-His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mmp-9-protein-mouse-hek293-c-his.html

Purity

95.0

Smiles

APYQRQPTFVVFPKDLKTSNLTDTQLAEAYLYRYGYTRAAQMMGEKQSLRPALLMLQKQLSLPQTGELDSQTLKAIRTPRCGVPDVGRFQTFKGLKWDHHNITYWIQNYSEDLPRDMIDDAFARAFAVWGEVAPLTFTRVYGPEADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGAGVQGDAHFDDDELWSLGKGVVIPTYYGNSNGAPCHFPFTFEGRSYSACTTDGRNDGTPWCSTTADYDKDGKFGFCPSERLYTEHGNGEGKPCVFPFIFEGRSYSACTTKGRSDGYRWCATTANYDQDKLYGFCPTRVDATVVGGNSAGELCVFPFVFLGKQYSSCTSDGRRDGRLWCATTSNFDTDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMYPLYSYLEGFPLNKDDIDGIQYLYGRGSKPDPRPPATTTTEPQPTAPPTMCPTIPPTAYPTVGPTVGPTGAPSPGPTSSPSPGPTGAPSPGPTAPPTAGSSEASTESLSPADNPCNVDVFDAIAEIQGALHFFKDGWYWKFLNHRGSPLQGPFLTARTWPALPATLDSAFEDPQTKRVFFFSGRQMWVYTGKTVLGPRSLDKLGLGPEVTHVSGLLPRRLGKALLFSKGRVWRFDLKSQKVDPQSVIRVDKEFSGVPWNSHDIFQYQDKAYFCHGKFFWRVSFQNEVNKVDHEVNQVDDVGYVTYDLLQCP

Molecular Formula

17395 (Gene_ID) P41245 (A20-P730) (Accession)

Molecular Weight

Approximately 93.64 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Brucella Suis rplM Protein (aa 1-154)
VAng-Lsx5624-1mgEcoli 1 mg (E. coli)

Recombinant Brucella Suis rplM Protein (aa 1-154)

Sign In for Pricing
View Details
OR2AG2 Lentiviral Activation Particles (h)
sc-417815-LAC 200 µL

OR2AG2 Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
PPP2R5E Recombinant Antibody, AbBy Fluor™ 350 Conjugated
bsm-62948R-BF350-01 20 µL

PPP2R5E Recombinant Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
PPP2R5E Recombinant Antibody, AbBy Fluor™ 350 Conjugated
bsm-62948R-BF350-02 100 µL

PPP2R5E Recombinant Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
CD161 (KLRB1) Mouse Monoclonal Antibody [Clone ID: OTI5F10]
TA809829 100 µL

CD161 (KLRB1) Mouse Monoclonal Antibody [Clone ID: OTI5F10]

Sign In for Pricing
View Details
TPBG Protein Vector (Human) (pPM-C-HA)
47345021 500 ng

TPBG Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details