Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MMP-9, Mouse (HEK293, C-His)

The MMP-9 protein is a matrix metalloproteinase that is critical for local extracellular matrix proteolysis and leukocyte migration.It is suggested that it may be involved in bone osteoclastic resorption.MMP-9 Protein, Mouse (HEK293, C-His) is the recombinant mouse-derived MMP-9 protein, expressed by HEK293 , with C-10*His labeled tag.

Product Specifications

Product Name Alternative

MMP-9 Protein, Mouse (HEK293, C-His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mmp-9-protein-mouse-hek293-c-his.html

Purity

95.0

Smiles

APYQRQPTFVVFPKDLKTSNLTDTQLAEAYLYRYGYTRAAQMMGEKQSLRPALLMLQKQLSLPQTGELDSQTLKAIRTPRCGVPDVGRFQTFKGLKWDHHNITYWIQNYSEDLPRDMIDDAFARAFAVWGEVAPLTFTRVYGPEADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGAGVQGDAHFDDDELWSLGKGVVIPTYYGNSNGAPCHFPFTFEGRSYSACTTDGRNDGTPWCSTTADYDKDGKFGFCPSERLYTEHGNGEGKPCVFPFIFEGRSYSACTTKGRSDGYRWCATTANYDQDKLYGFCPTRVDATVVGGNSAGELCVFPFVFLGKQYSSCTSDGRRDGRLWCATTSNFDTDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMYPLYSYLEGFPLNKDDIDGIQYLYGRGSKPDPRPPATTTTEPQPTAPPTMCPTIPPTAYPTVGPTVGPTGAPSPGPTSSPSPGPTGAPSPGPTAPPTAGSSEASTESLSPADNPCNVDVFDAIAEIQGALHFFKDGWYWKFLNHRGSPLQGPFLTARTWPALPATLDSAFEDPQTKRVFFFSGRQMWVYTGKTVLGPRSLDKLGLGPEVTHVSGLLPRRLGKALLFSKGRVWRFDLKSQKVDPQSVIRVDKEFSGVPWNSHDIFQYQDKAYFCHGKFFWRVSFQNEVNKVDHEVNQVDDVGYVTYDLLQCP

Molecular Formula

17395 (Gene_ID) P41245 (A20-P730) (Accession)

Molecular Weight

Approximately 93.64 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

BET1 (NM_005868) Human Over-expression Lysate
LH07920V 100 µg

BET1 (NM_005868) Human Over-expression Lysate

Sign In for Pricing
View Details
STOmL1 (NM_004809) Human Untagged Clone
SC117118 10 µg

STOmL1 (NM_004809) Human Untagged Clone

Sign In for Pricing
View Details
Recombinant Human JMJD7
MBS7609330-01 0.05 mg

Recombinant Human JMJD7

Sign In for Pricing
View Details
Recombinant Human JMJD7
MBS7609330-02 0.2 mg

Recombinant Human JMJD7

Sign In for Pricing
View Details
Recombinant Human JMJD7
MBS7609330-03 1 mg

Recombinant Human JMJD7

Sign In for Pricing
View Details
Recombinant Human JMJD7
MBS7609330-04 5x 1 mg

Recombinant Human JMJD7

Sign In for Pricing
View Details