Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MMP-9, Mouse (HEK293, C-His)

The MMP-9 protein is a matrix metalloproteinase that is critical for local extracellular matrix proteolysis and leukocyte migration.It is suggested that it may be involved in bone osteoclastic resorption.MMP-9 Protein, Mouse (HEK293, C-His) is the recombinant mouse-derived MMP-9 protein, expressed by HEK293 , with C-10*His labeled tag.

Product Specifications

Product Name Alternative

MMP-9 Protein, Mouse (HEK293, C-His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mmp-9-protein-mouse-hek293-c-his.html

Purity

95.0

Smiles

APYQRQPTFVVFPKDLKTSNLTDTQLAEAYLYRYGYTRAAQMMGEKQSLRPALLMLQKQLSLPQTGELDSQTLKAIRTPRCGVPDVGRFQTFKGLKWDHHNITYWIQNYSEDLPRDMIDDAFARAFAVWGEVAPLTFTRVYGPEADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGAGVQGDAHFDDDELWSLGKGVVIPTYYGNSNGAPCHFPFTFEGRSYSACTTDGRNDGTPWCSTTADYDKDGKFGFCPSERLYTEHGNGEGKPCVFPFIFEGRSYSACTTKGRSDGYRWCATTANYDQDKLYGFCPTRVDATVVGGNSAGELCVFPFVFLGKQYSSCTSDGRRDGRLWCATTSNFDTDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMYPLYSYLEGFPLNKDDIDGIQYLYGRGSKPDPRPPATTTTEPQPTAPPTMCPTIPPTAYPTVGPTVGPTGAPSPGPTSSPSPGPTGAPSPGPTAPPTAGSSEASTESLSPADNPCNVDVFDAIAEIQGALHFFKDGWYWKFLNHRGSPLQGPFLTARTWPALPATLDSAFEDPQTKRVFFFSGRQMWVYTGKTVLGPRSLDKLGLGPEVTHVSGLLPRRLGKALLFSKGRVWRFDLKSQKVDPQSVIRVDKEFSGVPWNSHDIFQYQDKAYFCHGKFFWRVSFQNEVNKVDHEVNQVDDVGYVTYDLLQCP

Molecular Formula

17395 (Gene_ID) P41245 (A20-P730) (Accession)

Molecular Weight

Approximately 93.64 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pfkl 3'UTR GFP Stable Cell Line
TU166229 1.0 mL

Pfkl 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Sdr42e1 3'UTR Lenti-reporter-Luc Vector
43273084 1.0 µg

Sdr42e1 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
POPDC2 Protein Vector (Mouse) (pPB-N-His)
PV217999 500 ng

POPDC2 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Frozen Tissue Sections, Anus
CS615482 5x 5 µm

Frozen Tissue Sections, Anus

Sign In for Pricing
View Details
Human Ataxin 1 (ATXN1) ELISA Kit
RDR-ATXN1-Hu-96Tests 96 Tests

Human Ataxin 1 (ATXN1) ELISA Kit

Sign In for Pricing
View Details
Mouse Tas2r102 qPCR Primer Pair
QM73962S 200 Tests

Mouse Tas2r102 qPCR Primer Pair

Sign In for Pricing
View Details