Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BSA Conjugated Pramlintide (PLT)

Product Specifications

Product Name Alternative

Symlin

Synonyms

Pramlintide

Expression System

Protein conjugation

Tag

N-terminal His Tag

Source

Protein conjugation

Applications

Immunogen; SDS-PAGE; WB.

Purity

> 90%

Form

Freeze-dried powder

Buffer

PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

Calculated Molecular Weight

> 66 KDa

Observed Molecular Weight

>66KDa

Fragment

KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY- (NH2)

Product Name Synonym

Pramlintide

Organism Species

Pan-species (General)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPIRE2 Polyclonal Antibody, FITC Conjugated
A51203-100 100 µL

SPIRE2 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
ACTA1/alpha-actin Antibody (C-term) Blocking peptide
MBS9222617-01 0.5 mg

ACTA1/alpha-actin Antibody (C-term) Blocking peptide

Sign In for Pricing
View Details
ACTA1/alpha-actin Antibody (C-term) Blocking peptide
MBS9222617-02 5x 0.5 mg

ACTA1/alpha-actin Antibody (C-term) Blocking peptide

Sign In for Pricing
View Details
DUSP5 (Dual specificity Phosphatase 5, DUSP, HVH3, OTTHUMP00000020476, VH1-like Phosphatase 3, Serine/threonine Specific Protein Phosphatase) APC
MBS6140076-01 0.1 mL

DUSP5 (Dual specificity Phosphatase 5, DUSP, HVH3, OTTHUMP00000020476, VH1-like Phosphatase 3, Serine/threonine Specific Protein Phosphatase) APC

Sign In for Pricing
View Details
DUSP5 (Dual specificity Phosphatase 5, DUSP, HVH3, OTTHUMP00000020476, VH1-like Phosphatase 3, Serine/threonine Specific Protein Phosphatase) APC
MBS6140076-02 5x 0.1 mL

DUSP5 (Dual specificity Phosphatase 5, DUSP, HVH3, OTTHUMP00000020476, VH1-like Phosphatase 3, Serine/threonine Specific Protein Phosphatase) APC

Sign In for Pricing
View Details
Cavy S100 Calcium Binding Protein A14 ELISA Kit
MBS072483 Inquire

Cavy S100 Calcium Binding Protein A14 ELISA Kit

Sign In for Pricing
View Details