Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFN-alpha 2/IFNA2, Rhesus Macaque (HEK293, His)

IFN-alpha 2 (IFNA2), belongs to type I interferon family, is a protein secreted by cells infected by a virus and acting on other cells to inhibit viral infection[1]. IFN-alpha 2 increases the frequencies of cytotoxic CD8+ T cells and induces CD4+ T cell depletion[3]. IFN-alpha 2/IFNA2 Protein, Rhesus Macaque (HEK293, His) contains 188 a.a. (M1-E188), is produced in HEK293 cells with a C-terminal His-tag.

Product Specifications

Product Name Alternative

IFN-alpha 2/IFNA2 Protein, Rhesus Macaque (HEK293, His), Rhesus Macaque, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ifn-alpha-2-ifna2-protein-rhesus-macaque-hek293-his.html

Purity

95.00

Smiles

CDLPQTHSLGNRRTLMLLAQMRRISLFFCLKDRHDFEFPQEEFGNQFQKAQTIPVLHEMIQQTFNLFSTKDSSAAWDETLLNKFYTELYQQLNDLEACVMQEMGVTETPLMNKNSILAVRKYFQRITLYLKEKKYSLCAWEVVRAEIMRSFSLSTNLQESLRSKE

Molecular Formula

709948 (Gene_ID) B6CK11 (C24-E188) (Accession)

Molecular Weight

Approximately 18-25 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Abraham S, et al. Gene therapy with plasmids encoding IFN-β or IFN-α14 confers long-term resistance to HIV-1 in humanized mice. Oncotarget. 2016 Nov 29;7 (48) :78412-78420.|[2]Zhang SY, et al. Inborn errors of interferon (IFN) -mediated immunity in humans: insights into the respective roles of IFN-alpha/beta, IFN-gamma, and IFN-lambda in host defense. Immunol Rev. 2008 Dec;226:29-40.|[3]Sutter K, et al. Interferon α subtypes in HIV infection. Cytokine Growth Factor Rev. 2018 Apr;40:13-18.|[4]Watanabe H, et al. Detailed structure of mouse interferon α2 and its interaction with Sortilin. J Biochem. 2021 Oct 11;170 (2) :265-273.|[5]Gull I, et al. Heterologous expression, immunochemical and computational analysis of recombinant human interferon alpha 2b. Springerplus. 2013 Jun 15;2 (1) :264.|[6]Paul F, et al. IFNA2: The prototypic human alpha interferon. Gene. 2015 Aug 10;567 (2) :132-7.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IgG Immunoglobulin (IG266), CF568 conjugate, 0.1mg/mL
BNC680266-500 1x 500 µL

Human IgG Immunoglobulin (IG266), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (AE-4), CF405S conjugate, 0.1mg/mL
BNC040096-500 1x 500 µL

Histone H1 (AE-4), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF594 conjugate, 0.1mg/mL
BNC941050-100 1x 100 µL

CD3e (CRIS-7), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (C-51), CF568 conjugate, 0.1mg/mL
BNC680034-100 1x 100 µL

Cytokeratin 8/18 (C-51), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF680 conjugate, 0.1mg/mL
BNC800146-100 1x 100 µL

CD10 (CB-CALLA), CF680 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 / ICAM3 (ICAM3/2873R), CF568 conjugate, 0.1mg/mL
BNC682873-100 1x 100 µL

CD50 / ICAM3 (ICAM3/2873R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details