Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBP4, Human (HEK293, hFc)

RBP4 protein acts as a retinol-binding protein, essential for transporting retinol in blood plasma. It facilitates the delivery of retinol from the liver to peripheral tissues and likely transfers bound all-trans retinol to STRA6 for cell membrane transport. Interactions with TTR prevent kidney glomeruli filtration loss. Direct interaction with STRA6 underscores RBP4's role in intricate retinol transport and distribution processes in the body. RBP4 Protein, Human (HEK293, hFc) is the recombinant human-derived RBP4 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

RBP4 Protein, Human (HEK293, hFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rbp4-protein-human-hek-293-hfc.html

Purity

97.00

Smiles

ERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL

Molecular Formula

5950 (Gene_ID) P02753 (E19-L201) (Accession)

Molecular Weight

Approximately 53 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD43 (84-3C1), CF405S conjugate, 0.1mg/mL
BNC040342-500 1x 500 µL

CD43 (84-3C1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF594 conjugate, 0.1mg/mL
BNC941037-100 1x 100 µL

CD44 Standard (DF1485), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD53 (161-2), CF640R conjugate, 0.1mg/mL
BNC400324-500 1x 500 µL

CD53 (161-2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), CF740 conjugate, 0.1mg/mL
BNC740257-100 1x 100 µL

Cytokeratin, HMW (AE-3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pmel17 / gp100 / SILV (NKI-beteb), CF568 conjugate, 0.1mg/mL
BNC680226-100 1x 100 µL

Pmel17 / gp100 / SILV (NKI-beteb), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF594 conjugate, 0.1mg/mL
BNC940333-100 1x 100 µL

CD8 (RIV11), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details