Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Aminopeptidase P1, Human (His)

Aminopeptidase P1 Protein, Human (His) is a recombinant human Aminopeptidase P1 with a His tag at the C-terminus. Aminopeptidase P1 belongs to a family of aminopeptidase Ps (aminopeptidases P1-3 encoded by the Xpnpep1-3 genes) that cleave the N-terminal amino acid residue of peptides in which the penultimate amino acid is proline[1].

Product Specifications

Product Name Alternative

Aminopeptidase P1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/aminopeptidase-p1-protein-human-his.html

Purity

86.0

Smiles

PPKVTSELLRQLRQAMRNSEYVTEPIQAYIIPSGDAHQSEYIAPCDCRRAFVSGFDGSAGTAIITEEHAAMWTDGRYFLQAAKQMDSNWTLMKMGLKDTPTQEDWLVSVLPEGSRVGVDPLIIPTDYWKKMAKVLRSAGHHLIPVKENLVDKIWTDRPERPCKPLLTLGLDYTGISWKDKVADLRLKMAERNVMWFVVTALDEIAWLFNLRGSDVEHNPVFFSYAIIGLETIMLFIDGDRIDAPSVKEHLLLDLGLEAEYRIQVHPYKSILSELKALCADLSPREKVWVSDKASYAVSETIPKDHRCCMPYTPICIAKAVKNSAESEGMRRAHIKDAVALCELFNWLEKEVPKGGVTEISAADKAEEFRRQQADFVDLSFPTISSTGPNGAIIHYAPVPETNRTLSLDEVYLIDSGAQYKDGTTDVTRTMHFGTPTAYEKECFTYVLKGHIAVSAAVFPTGTKGHLLDSFARSALWDSGLDYLHGTGHGVGSFLNVHEGPCGISYKTFSDEPLEAGMIVTDEPGYYEDGAFGIRIENVVLVVPVKTKYNFNNRGSLTFEPLTLVPIQTKMIDVDSLTDKECDWLNNYHLTCRDVIGKELQKQGRQEALEWLIRETQPISKQ

Molecular Formula

7511 (Gene_ID) Q9NQW7 (P2-Q622) (Accession)

Molecular Weight

Approximately 77.0 kDa

References & Citations

[1]Yoon SH, et al. Developmental retardation, microcephaly, and peptiduria in mice without aminopeptidase P1. Biochem Biophys Res Commun. 2012 Dec 14;429 (3-4) :204-9.

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mrps15 sgRNA CRISPR Lentivector (Rat) (Target 2)
K7140103 1.0 µg DNA

Mrps15 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
CK7 Mouse Monoclonal Antibody (BF594)
orb1593664 100 µL

CK7 Mouse Monoclonal Antibody (BF594)

Sign In for Pricing
View Details
Lentiviral mouse Wnt16 shRNA (UAS) - Lentiviral mouse Wnt16 shRNA (UAS) (25)
GTR15203453 1 Vial

Lentiviral mouse Wnt16 shRNA (UAS) - Lentiviral mouse Wnt16 shRNA (UAS) (25)

Sign In for Pricing
View Details
ZFAND5 Mouse Monoclonal Antibody [Clone ID: OTI2F4]
CF800479 100 µg

ZFAND5 Mouse Monoclonal Antibody [Clone ID: OTI2F4]

Sign In for Pricing
View Details
Canine Eosinophil-Associated Ribonuclease A Family Member 12 ELISA Kit
MBS018435-01 48 Well

Canine Eosinophil-Associated Ribonuclease A Family Member 12 ELISA Kit

Sign In for Pricing
View Details
Canine Eosinophil-Associated Ribonuclease A Family Member 12 ELISA Kit
MBS018435-02 96 Well

Canine Eosinophil-Associated Ribonuclease A Family Member 12 ELISA Kit

Sign In for Pricing
View Details