Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IgG4 Fc, Human (HEK293)

The IgG4 Fc is the constant region of the immunoglobulin heavy chain, which forms the backbone of antibodies crucial in humoral immunity. B lymphocytes produce glycoprotein antibodies that initiate clonal expansion upon antigen binding. IgG4 Fc Protein, Human (HEK293) is the recombinant human-derived IgG4 Fc protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

IgG4 Fc Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/igg4-fc-protein-human-hek-293.html

Purity

98.0

Smiles

ESKYGPPCPSCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLG

Molecular Formula

3503 (Gene_ID) P01861-1 (E99-G326) (Accession)

Molecular Weight

Approximately 30-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD4 (EDU-2), CF568 conjugate, 0.1mg/mL
BNC680345-100 1x 100 µL

CD4 (EDU-2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF568 conjugate, 0.1mg/mL
BNC680175-500 1x 500 µL

CD46 (122.2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD100 (Semaphorin-4D) (A8), CF405S conjugate, 0.1mg/mL
BNC040218-500 1x 500 µL

CD100 (Semaphorin-4D) (A8), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF594 conjugate, 0.1mg/mL
BNC940158-500 1x 500 µL

Cytokeratin 17 (E3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (Heat Shock Protein 27) (rHSPB1/774), CF647 conjugate, 0.1mg/mL
BNC472308-500 1x 500 µL

HSP27 (Heat Shock Protein 27) (rHSPB1/774), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (LN-2), CF405S conjugate, 0.1mg/mL
BNC040056-500 1x 500 µL

CD74 (LN-2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details