Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Trypsin-3 (PRSS3), partial

Product Specifications

Product Name Alternative

Brain trypsinogen; Mesotrypsinogen; Serine protease 3Serine protease 4Trypsin IIITrypsin IV

Abbreviation

Recombinant Human PRSS3 protein, partial

Gene Name

PRSS3

UniProt

P35030

Expression Region

81-303aa

Organism

Homo sapiens (Human)

Target Sequence

IVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAHCYKTRIQVRLGEHNIKVLEGNEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTTPPAAGTECLISGWGNTLSFGADYPDELKCLDAPVLTQAECKASYPGKITNSMFCVGFLEGGKDSCQRDSGGPVVCNGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWIKDTIAAN

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Digestive protease specialized for the degradation of trypsin inhibitors. In the ileum, may be involved in defensin processing, including DEFA5.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Digestive protease specialized for the degradation of trypsin inhibitors. In the ileum, may be involved in defensin processing, including DEFA5.

Molecular Weight

28.2 kDa

References & Citations

Cloning of the cDNA encoding human brain trypsinogen and characterization of its product.Wiegand U., Corbach S., Minn A., Kang J., Mueller-Hill B.Gene 136:167-175 (1993)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human FBN1 (Fibrillin 1) ELISA Kit
RE2331H-01 48 Tests

Human FBN1 (Fibrillin 1) ELISA Kit

Sign In for Pricing
View Details
Human FBN1 (Fibrillin 1) ELISA Kit
RE2331H-02 96 Tests

Human FBN1 (Fibrillin 1) ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Odf3 shRNA (UAS) - Lentiviral mouse Odf3 shRNA (UAS, iRFP) (100)
GTR15143559 1 Vial

Lentiviral mouse Odf3 shRNA (UAS) - Lentiviral mouse Odf3 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Recombinant Human CDK5 Protein, N-His
bs-101742P-01 20 µg

Recombinant Human CDK5 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human CDK5 Protein, N-His
bs-101742P-02 50 µg

Recombinant Human CDK5 Protein, N-His

Sign In for Pricing
View Details
Glutamate Receptor delta-1 subunit (GRID1) Rat ELISA Kit
D7260 96 Tests

Glutamate Receptor delta-1 subunit (GRID1) Rat ELISA Kit

Sign In for Pricing
View Details