Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

M-CSF, Mouse

The M-CSF protein is a key orchestrator in regulating the survival, proliferation, and differentiation of hematopoietic precursor cells, particularly mononuclear phagocytes, including macrophages and monocytes. It actively promotes the release of pro-inflammatory chemokines, thereby playing a key role in innate immunity and inflammatory processes. M-CSF Protein, Mouse is the recombinant mouse-derived M-CSF protein, expressed by E. coli.

Product Specifications

Product Name Alternative

M-CSF Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/m-csf-protein-mouse.html

Purity

98.0

Smiles

KEVSEHCSHMIGNGHLKVLQQLIDSQMETSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATERLQELSNNLNSCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLEKDWNIFTKNCNNSFAKCSSRDVVTKP

Molecular Formula

12977 (Gene_ID) P07141-1 (K33-P187) (Accession)

Molecular Weight

Approximately 18 kDa under reduced (R) conditions, 33 kDa under non reducing (N) conditions, based on SDS-PAGE.

References & Citations

[1]Hamilton JA. Colony-stimulating factors in inflammation and autoimmunity. Nat Rev Immunol. 2008 Jul;8 (7) :533-44.|[2]Rioja I, et al. Potential novel biomarkers of disease activity in rheumatoid arthritis patients: CXCL13, CCL23, transforming growth factor alpha, tumor necrosis factor receptor superfamily member 9, and macrophage colony-stimulating factor. Arthritis Rheum. 2008 Aug;58 (8) :2257-67.|[3]Mu W, et al., Carnosic Acid Directly Targets STING C-Terminal Tail to Improve STING-Mediated Inflammatory Diseases. Adv Sci (Weinh) . 2025 Apr;12 (14) :e2417686.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Anti-BSG antibody
STJ119091 100 µl

Anti-BSG antibody

Ask
View Details
Hsa-miR-145-3p miRNA Mimic
CMH0544-01 5 nmol

Hsa-miR-145-3p miRNA Mimic

Ask
View Details
Hsa-miR-145-3p miRNA Mimic
CMH0544-02 10 nmol

Hsa-miR-145-3p miRNA Mimic

Ask
View Details
CROCCP3 Antibody
KC-3584-01 50 μL

CROCCP3 Antibody

Ask
View Details
CROCCP3 Antibody
KC-3584-02 100 µL

CROCCP3 Antibody

Ask
View Details
CROCCP3 Antibody
KC-3584-03 1 mL

CROCCP3 Antibody

Ask
View Details