Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EGF, Rat

EGF Protein, Rat is a potent epidermal growth factor, promotes epithelial proliferation and migration, and increases epithelial wound closure and shortens healing time.

Product Specifications

Product Name Alternative

EGF Protein, Rat, Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/egf-protein-rat.html

Purity

97.00

Smiles

NSNTGCPPSYDGYCLNGGVCMYVESVDRYVCNCVIGYIGERCQHRDLRWWKLR

Molecular Formula

25313 (Gene_ID) P07522/NP_036974.1 (N974-R1026) (Accession)

Molecular Weight

Approximately 6-9 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Palencia L, et al. Epidermal growth factor mediated healing in stem cell-derived vocal fold mucosa. J Surg Res. 2015 Jul;197 (1) :32-8.|[2]Choi SY, et al. Epidermal Growth Factor Relieves Inflammatory Signals in Staphylococcus aureus-Treated Human Epidermal Keratinocytes and Atopic Dermatitis-Like Skin Lesions in Nc/Nga Mice. Biomed Res Int. 2018 May 15;2018:9439182.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRL (Prolactin) (APC)
131833-APC 100 µL

PRL (Prolactin) (APC)

Sign In for Pricing
View Details
Mouse Protein O-Glucosyltransferase 1,POGLUT1 ELISA KIT
JOT-EK0720Mo 96 wells

Mouse Protein O-Glucosyltransferase 1,POGLUT1 ELISA KIT

Sign In for Pricing
View Details
TCR, V beta 7 (T Cell Receptor) (PE) discontinued
T2040-23E 500 µL

TCR, V beta 7 (T Cell Receptor) (PE) discontinued

Sign In for Pricing
View Details
AADACL2 Polyclonal Antibody, PE Conjugated
bs-11385R-PE 100 µL

AADACL2 Polyclonal Antibody, PE Conjugated

Sign In for Pricing
View Details
Pepinemab Biosimilar - Research Grade
ICH5768-10mg 10 mg (2x 5 mg)

Pepinemab Biosimilar - Research Grade

Sign In for Pricing
View Details
THYN1
CSB-CL023526HU 10 μg Plasmid + 200 μL Glycerol

THYN1

Sign In for Pricing
View Details