What is the catalog number for EGF, Rat?

The catalog number for EGF, Rat is HY-P7092.

What sizes are available for EGF, Rat?

EGF, Rat is available in the following size(s): 2 µg, 10 µg, 50 µg, 100 µg, 250 µg, 500 µg.

How many pack sizes does EGF, Rat come in?

EGF, Rat is available in 6 different pack sizes.

Is EGF, Rat in stock?

EGF, Rat is currently made to order / not held in immediate stock. Contact us for lead time.

Who manufactures EGF, Rat?

EGF, Rat is manufactured by QuantiMol.

What is the estimated delivery time for EGF, Rat?

Estimated delivery time for EGF, Rat is approximately 15 business day(s), depending on your location.

EGF, Rat

EGF Protein, Rat is a potent epidermal growth factor, promotes epithelial proliferation and migration, and increases epithelial wound closure and shortens healing time.

Product Specifications

Product Name Alternative

EGF Protein, Rat, Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/egf-protein-rat.html

Purity

97.00

Smiles

NSNTGCPPSYDGYCLNGGVCMYVESVDRYVCNCVIGYIGERCQHRDLRWWKLR

Molecular Formula

25313 (Gene_ID) P07522/NP_036974.1 (N974-R1026) (Accession)

Molecular Weight

Approximately 6-9 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Palencia L, et al. Epidermal growth factor mediated healing in stem cell-derived vocal fold mucosa. J Surg Res. 2015 Jul;197 (1) :32-8.|[2]Choi SY, et al. Epidermal Growth Factor Relieves Inflammatory Signals in Staphylococcus aureus-Treated Human Epidermal Keratinocytes and Atopic Dermatitis-Like Skin Lesions in Nc/Nga Mice. Biomed Res Int. 2018 May 15;2018:9439182.