Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EGF, Rat

EGF Protein, Rat is a potent epidermal growth factor, promotes epithelial proliferation and migration, and increases epithelial wound closure and shortens healing time.

Product Specifications

Product Name Alternative

EGF Protein, Rat, Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/egf-protein-rat.html

Purity

97.00

Smiles

NSNTGCPPSYDGYCLNGGVCMYVESVDRYVCNCVIGYIGERCQHRDLRWWKLR

Molecular Formula

25313 (Gene_ID) P07522/NP_036974.1 (N974-R1026) (Accession)

Molecular Weight

Approximately 6-9 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Palencia L, et al. Epidermal growth factor mediated healing in stem cell-derived vocal fold mucosa. J Surg Res. 2015 Jul;197 (1) :32-8.|[2]Choi SY, et al. Epidermal Growth Factor Relieves Inflammatory Signals in Staphylococcus aureus-Treated Human Epidermal Keratinocytes and Atopic Dermatitis-Like Skin Lesions in Nc/Nga Mice. Biomed Res Int. 2018 May 15;2018:9439182.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNAAF11 Mouse Monoclonal Antibody [Clone ID: LBI6D4]
AMM17200VCF 100 µg

DNAAF11 Mouse Monoclonal Antibody [Clone ID: LBI6D4]

Sign In for Pricing
View Details
Human CELF-4 Protein
orb1476114-01 50 µg

Human CELF-4 Protein

Sign In for Pricing
View Details
Human CELF-4 Protein
orb1476114-02 500 µg

Human CELF-4 Protein

Sign In for Pricing
View Details
Olfr1248 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
32705124 3x 1.0µg DNA

Olfr1248 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
ZFPM2 Antibody (C-term)
E45R14030G-1 100 µL

ZFPM2 Antibody (C-term)

Sign In for Pricing
View Details
Chicken DCN1-like protein 1, DCUN1D1 ELISA Kit
MBS9335008 Inquire

Chicken DCN1-like protein 1, DCUN1D1 ELISA Kit

Sign In for Pricing
View Details