Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-13, Human (HEK293, mFc)

IL-13 Protein, Human (HEK 293, mFc) is a cytokine which affects the morphology, growth, and surface antigen expression and phenotype of monocytes and elicits B cell proliferation. IL-13 Protein, Human (HEK 293, mFc) is a recombinant human interleukin-13 (rhIL-13) expressed in HEK 293 cells with the mFc tag.

Product Specifications

Product Name Alternative

IL-13 Protein, Human (HEK293, mFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-13-protein-human-hek293-mfc.html

Purity

98.0

Smiles

GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN

Molecular Formula

3596 (Gene_ID) AAK53823.1 (G21-N132) (Accession)

Molecular Weight

38-60 kDa

References & Citations

[1]Cannon-Carlson S, et al. Expression, purification, and characterization of recombinant human interleukin-13 from NS-O cells. Protein Expr Purif. 1998 Mar;12 (2) :239-48.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

MURF2 (TRIM55) (NM_184086) Human Recombinant Protein
TP302934M 100 µg

MURF2 (TRIM55) (NM_184086) Human Recombinant Protein

Ask
View Details
Mouse Monoclonal Zebrafish Gut Secretory Cell Epitopes Antibody (FIS 2F11/2) [mFluor Violet 500 SE]
NBP2-50375MFV500 0.1 mL

Mouse Monoclonal Zebrafish Gut Secretory Cell Epitopes Antibody (FIS 2F11/2) [mFluor Violet 500 SE]

Ask
View Details
Alpha 2 Antiplasmin/SerpinF2 Protein, Human, Recombinant (His Tag)
PH51279M2 50 µg

Alpha 2 Antiplasmin/SerpinF2 Protein, Human, Recombinant (His Tag)

Ask
View Details
Rat Il10rb Pre-designed siRNA Set B
SI206644B 1 Each

Rat Il10rb Pre-designed siRNA Set B

Ask
View Details