Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-13, Human (HEK293, mFc)

IL-13 Protein, Human (HEK 293, mFc) is a cytokine which affects the morphology, growth, and surface antigen expression and phenotype of monocytes and elicits B cell proliferation. IL-13 Protein, Human (HEK 293, mFc) is a recombinant human interleukin-13 (rhIL-13) expressed in HEK 293 cells with the mFc tag.

Product Specifications

Product Name Alternative

IL-13 Protein, Human (HEK293, mFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-13-protein-human-hek293-mfc.html

Purity

98.0

Smiles

GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN

Molecular Formula

3596 (Gene_ID) AAK53823.1 (G21-N132) (Accession)

Molecular Weight

38-60 kDa

References & Citations

[1]Cannon-Carlson S, et al. Expression, purification, and characterization of recombinant human interleukin-13 from NS-O cells. Protein Expr Purif. 1998 Mar;12 (2) :239-48.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr386 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K7194405 3x 1.0 µg

Olr386 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Zfp282 Protein Vector (Rat) (pPB-C-His)
PV317626 500 ng

Zfp282 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Human Dual Specificity Phosphatase 6,DUSP6 ELISA KIT
JOT-EK2503Hu 96 wells

Human Dual Specificity Phosphatase 6,DUSP6 ELISA KIT

Sign In for Pricing
View Details
Plod3 Rat shRNA Plasmid (Locus ID 288583)
TL713484 1 Kit

Plod3 Rat shRNA Plasmid (Locus ID 288583)

Sign In for Pricing
View Details
Lentiviral human PACC1 shRNA (UAS) - Lentiviral human PACC1 shRNA (UAS) (25)
GTR15080453 1 Vial

Lentiviral human PACC1 shRNA (UAS) - Lentiviral human PACC1 shRNA (UAS) (25)

Sign In for Pricing
View Details
ZNF596 Polyclonal Antibody
RA36609-01 50 µL

ZNF596 Polyclonal Antibody

Sign In for Pricing
View Details