Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-13, Human (HEK293, mFc)

IL-13 Protein, Human (HEK 293, mFc) is a cytokine which affects the morphology, growth, and surface antigen expression and phenotype of monocytes and elicits B cell proliferation. IL-13 Protein, Human (HEK 293, mFc) is a recombinant human interleukin-13 (rhIL-13) expressed in HEK 293 cells with the mFc tag.

Product Specifications

Product Name Alternative

IL-13 Protein, Human (HEK293, mFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-13-protein-human-hek293-mfc.html

Purity

98.0

Smiles

GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN

Molecular Formula

3596 (Gene_ID) AAK53823.1 (G21-N132) (Accession)

Molecular Weight

38-60 kDa

References & Citations

[1]Cannon-Carlson S, et al. Expression, purification, and characterization of recombinant human interleukin-13 from NS-O cells. Protein Expr Purif. 1998 Mar;12 (2) :239-48.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Monkey GMCSF/CSF2(Granulocyte Macrophage Colony Stimulating Factor 2) ELISA Kit
MBS2511438-01 24 Tests (Limit 1)

Monkey GMCSF/CSF2(Granulocyte Macrophage Colony Stimulating Factor 2) ELISA Kit

Ask
View Details
Monkey GMCSF/CSF2(Granulocyte Macrophage Colony Stimulating Factor 2) ELISA Kit
MBS2511438-02 48 Tests

Monkey GMCSF/CSF2(Granulocyte Macrophage Colony Stimulating Factor 2) ELISA Kit

Ask
View Details
Monkey GMCSF/CSF2(Granulocyte Macrophage Colony Stimulating Factor 2) ELISA Kit
MBS2511438-03 96 Tests

Monkey GMCSF/CSF2(Granulocyte Macrophage Colony Stimulating Factor 2) ELISA Kit

Ask
View Details
Monkey GMCSF/CSF2(Granulocyte Macrophage Colony Stimulating Factor 2) ELISA Kit
MBS2511438-04 5x 96 Tests

Monkey GMCSF/CSF2(Granulocyte Macrophage Colony Stimulating Factor 2) ELISA Kit

Ask
View Details
Monkey GMCSF/CSF2(Granulocyte Macrophage Colony Stimulating Factor 2) ELISA Kit
MBS2511438-05 10x 96 Tests

Monkey GMCSF/CSF2(Granulocyte Macrophage Colony Stimulating Factor 2) ELISA Kit

Ask
View Details
Human PTPLA (HACD1) activation kit by CRISPRa
GA106132 1 Kit

Human PTPLA (HACD1) activation kit by CRISPRa

Ask
View Details