Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-13, Human (HEK293, mFc)

IL-13 Protein, Human (HEK 293, mFc) is a cytokine which affects the morphology, growth, and surface antigen expression and phenotype of monocytes and elicits B cell proliferation. IL-13 Protein, Human (HEK 293, mFc) is a recombinant human interleukin-13 (rhIL-13) expressed in HEK 293 cells with the mFc tag.

Product Specifications

Product Name Alternative

IL-13 Protein, Human (HEK293, mFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-13-protein-human-hek293-mfc.html

Purity

98.0

Smiles

GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN

Molecular Formula

3596 (Gene_ID) AAK53823.1 (G21-N132) (Accession)

Molecular Weight

38-60 kDa

References & Citations

[1]Cannon-Carlson S, et al. Expression, purification, and characterization of recombinant human interleukin-13 from NS-O cells. Protein Expr Purif. 1998 Mar;12 (2) :239-48.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR2M1P sgRNA CRISPR Lentivector (Human) (Target 1)
K1496802 1.0 µg DNA

OR2M1P sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
APC Anti-Human CD62L Antibody
RD20704F-01 20 Tests

APC Anti-Human CD62L Antibody

Sign In for Pricing
View Details
APC Anti-Human CD62L Antibody
RD20704F-02 100 Tests

APC Anti-Human CD62L Antibody

Sign In for Pricing
View Details
APC Anti-Human CD62L Antibody
RD20704F-03 2x 100 Tests

APC Anti-Human CD62L Antibody

Sign In for Pricing
View Details
Mouse HIF-1α(Hypoxia Inducible Factor 1 Alpha) ELISA Kit
SYP-M0174-01 48 Well

Mouse HIF-1α(Hypoxia Inducible Factor 1 Alpha) ELISA Kit

Sign In for Pricing
View Details
Mouse HIF-1α(Hypoxia Inducible Factor 1 Alpha) ELISA Kit
SYP-M0174-02 96 Well

Mouse HIF-1α(Hypoxia Inducible Factor 1 Alpha) ELISA Kit

Sign In for Pricing
View Details