Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-13, Human (HEK293, mFc)

IL-13 Protein, Human (HEK 293, mFc) is a cytokine which affects the morphology, growth, and surface antigen expression and phenotype of monocytes and elicits B cell proliferation. IL-13 Protein, Human (HEK 293, mFc) is a recombinant human interleukin-13 (rhIL-13) expressed in HEK 293 cells with the mFc tag.

Product Specifications

Product Name Alternative

IL-13 Protein, Human (HEK293, mFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-13-protein-human-hek293-mfc.html

Purity

98.0

Smiles

GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN

Molecular Formula

3596 (Gene_ID) AAK53823.1 (G21-N132) (Accession)

Molecular Weight

38-60 kDa

References & Citations

[1]Cannon-Carlson S, et al. Expression, purification, and characterization of recombinant human interleukin-13 from NS-O cells. Protein Expr Purif. 1998 Mar;12 (2) :239-48.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TLK2, Human (749a.a, sf9, His, GST)
HY-P702737 1 Each

TLK2, Human (749a.a, sf9, His, GST)

Sign In for Pricing
View Details
PPIAL4A Human shRNA Lentiviral Particle (Locus ID 653505)
TL321315V 500 µL Each

PPIAL4A Human shRNA Lentiviral Particle (Locus ID 653505)

Sign In for Pricing
View Details
EMAP II Polyclonal Conjugated Antibody
MBS9450453-01 0.1 mL (Biotin)

EMAP II Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
EMAP II Polyclonal Conjugated Antibody
MBS9450453-02 0.1 mL (AF350)

EMAP II Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
EMAP II Polyclonal Conjugated Antibody
MBS9450453-03 0.1 mL (AF405)

EMAP II Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
EMAP II Polyclonal Conjugated Antibody
MBS9450453-04 0.1 mL (AF488)

EMAP II Polyclonal Conjugated Antibody

Sign In for Pricing
View Details