IL-32, Human (HEK293, His)
IL-32 protein is a member of the cytokine family whose expression increases following T cell activation or IL-2-induced NK cell activation. It plays a key role in inducing macrophages to produce TNFα, which contributes to the inflammatory response. IL-32 alphaProtein, Human (HEK293, His) is the recombinant human-derived IL-32 alpha protein, expressed by HEK293 , with C-His labeled tag.
Product Specifications
Product Name Alternative
IL-32 alpha Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/il-32-protein-human-hek293-his.html
Purity
98.00
Smiles
MCFPKVLSDDMKKLKARMHQAIERFYDKMQNAESGRGQVMSSLAELEDDFKEGYLETVAAYYEEQHPELTPLLEKERDGLRCRGNRSPVPDVEDPATEEPGESFCDKSYGAPRGDKEELTPQKCSEPQSSK
Molecular Formula
9235 (Gene_ID) P24001-4/NP_001012651 (M1-K131) (Accession)
Molecular Weight
Approximately 20 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
Human IgG Immunoglobulin (IG266), CF488A conjugate, 0.1mg/mL
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF740 conjugate, 0.1mg/mL
CD44 Standard (156-3C11), CF647 conjugate, 0.1mg/mL
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF740 conjugate, 0.1mg/mL
Human IgG Immunoglobulin (IG266), CF568 conjugate, 0.1mg/mL
