FGF-1, Canine
The FGF-1 protein is critical in cellular regulation, coordinating key processes such as cell survival, division, angiogenesis, differentiation and migration. It exhibits potent mitogenic properties in vitro and serves as a ligand for FGFR1 and integrins. FGF-1 Protein, Canine is the recombinant canine-derived FGF-1 protein, expressed by E. coli , with tag free.
Product Specifications
Product Name Alternative
FGF-1 Protein, Canine, Canine, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/fgf-1-protein-canine.html
Purity
90.0
Smiles
FNLPPGNYMKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
Molecular Formula
607724 (Gene_ID) J9NTP4 (F16-D155) (Accession)
Molecular Weight
Approximately 16 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
PE-Linked Polyclonal Antibody to Heat Shock Protein 47 (HSP47)
PE-Linked Polyclonal Antibody to Heat Shock Protein 47 (HSP47)
PE-Linked Polyclonal Antibody to Heat Shock Protein 47 (HSP47)
PE-Linked Polyclonal Antibody to Heat Shock Protein 47 (HSP47)
PE-Linked Polyclonal Antibody to Heat Shock Protein 47 (HSP47)
