LHPP, Human (His-SUMO)
LHPP Protein, a phosphatase, exhibits broad substrate specificity, efficiently hydrolyzing imidodiphosphate, 3-phosphohistidine, and 6-phospholysine. It can also hydrolyze inorganic diphosphate, albeit less efficiently. LHPP Protein, Human (His-SUMO) is the recombinant human-derived LHPP protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.
Product Specifications
Product Name Alternative
LHPP Protein, Human (His-SUMO), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/lhpp-protein-human-his-sumo.html
Purity
95.0
Smiles
MAPWGKRLAGVRGVLLDISGVLYDSGAGGGTAIAGSVEAVARLKRSRLKVRFCTNESQKSRAELVGQLQRLGFDISEQEVTAPAPAACQILKEQGLRPYLLIHDGVRSEFDQIDTSNPNCVVIADAGESFSYQNMNNAFQVLMELEKPVLISLGKGRYYKETSGLMLDVGPYMKALEYACGIKAEVVGKPSPEFFKSALQAIGVEAHQAVMIGDDIVGDVGGAQRCGMRALQVRTGKFRPSDEHHPEVKADGYVDNLAEAVDLLLQHADK
Molecular Formula
64077 (Gene_ID) Q9H008-1 (M1-K270) (Accession)
Molecular Weight
Approximately 45.2 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC471231-100 1x 100 µL
Eosinophil Peroxidase (AHE-1), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740352-500 1x 500 µL
CD31 / PECAM-1 (158-2B3), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740149-100 1x 100 µL
CD106 / VCAM1 (1.4C3), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740923-500 1x 500 µL
Myosin, Smooth Muscle Heavy Chain (MYH11/923), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details