Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse 14-3-3 protein eta (Ywhah)

Product Specifications

Abbreviation

Recombinant Mouse Ywhah protein

Gene Name

Ywhah

UniProt

P68510

Expression Region

2-246aa

Organism

Mus musculus (Mouse)

Target Sequence

GDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLALLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEHMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGN

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. Negatively regulates the kinase activity of PDPK1.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

35.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-CRMP2 (Thr514+Ser518) Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-8284R-BF750 100 µL

Phospho-CRMP2 (Thr514+Ser518) Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
Recombinant Clostridium Thermocellum mtaD Protein (aa 1-431)
VAng-Lsx01997-50gEcoli 50 µg (E. coli)

Recombinant Clostridium Thermocellum mtaD Protein (aa 1-431)

Sign In for Pricing
View Details
Satb2 Rat shRNA Lentiviral Particle (Locus ID 501145)
TL707808V 500 µL Each

Satb2 Rat shRNA Lentiviral Particle (Locus ID 501145)

Sign In for Pricing
View Details
Rabbit Anti-PGM1 Polyclonal Antibody
PAV4207 100 μL

Rabbit Anti-PGM1 Polyclonal Antibody

Sign In for Pricing
View Details
Human TNFRSF21 (Tumor necrosis factor receptor superfamily member 21) ELISA Kit
MBS7612617-01 48 Well

Human TNFRSF21 (Tumor necrosis factor receptor superfamily member 21) ELISA Kit

Sign In for Pricing
View Details
Human TNFRSF21 (Tumor necrosis factor receptor superfamily member 21) ELISA Kit
MBS7612617-02 96 Well

Human TNFRSF21 (Tumor necrosis factor receptor superfamily member 21) ELISA Kit

Sign In for Pricing
View Details