Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Dickkopf-related protein 4 (Dkk4)

Product Specifications

Product Name Alternative

Dickkopf-4; Dkk-4

Abbreviation

Recombinant Mouse Dkk4 protein

Gene Name

Dkk4

UniProt

Q8VEJ3

Expression Region

19-221aa

Organism

Mus musculus (Mouse)

Target Sequence

LVLDFNNIKSSADVQGAGKGSLCASDRDCSEGKFCLAFHDERSFCATCRRVRRRCQRSAVCCPGTVCVNDVCTAVEDTRPVMDRNTDGQDGAYAEGTTKWPAEENRPQGKPSTKKSQSSKGQEGESCLRTSDCGPGLCCARHFWTKICKPVLREGQVCSRRGHKDTAQAPEIFQRCDCGPGLTCRSQVTSNRQHSRLRVCQRI

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Immunology

Relevance

Antagonizes canonical Wnt signaling by inhibiting LRP5/6 interaction with Wnt and by forming a ternary complex with the transmembrane protein KREMEN that promotes internalization of LRP5/6. DKKs play an important role in vertebrate development, where they locally inhibit Wnt regulated processes such as antero-posterior axial patterning, limb development, somitogenesis and eye formation. In the adult, Dkks are implicated in bone formation and bone disease, cancer and Alzheimer disease.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

35.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NCAM Antibody (isoform 2)
R34362-100UG 100 µg

NCAM Antibody (isoform 2)

Sign In for Pricing
View Details
RBM7 Antibody - middle region : HRP (ARP40830_P050-HRP)
ARP40830_P050-HRP 100 µL

RBM7 Antibody - middle region : HRP (ARP40830_P050-HRP)

Sign In for Pricing
View Details
500ml Amber Color Round PP Storage Bottle, Wide Mouth, Sterile, 5/pk, 50/cs
CS0063-341201 1 Each

500ml Amber Color Round PP Storage Bottle, Wide Mouth, Sterile, 5/pk, 50/cs

Sign In for Pricing
View Details
Human FGF21 (Fibroblast Growth Factor 21) CLIA Kit
MBS2530652-01 96 Tests

Human FGF21 (Fibroblast Growth Factor 21) CLIA Kit

Sign In for Pricing
View Details
Human FGF21 (Fibroblast Growth Factor 21) CLIA Kit
MBS2530652-02 5x 96 Tests

Human FGF21 (Fibroblast Growth Factor 21) CLIA Kit

Sign In for Pricing
View Details
Anti-FSTL1 Antibody (4I682)
TMAY-03848 100 µL

Anti-FSTL1 Antibody (4I682)

Sign In for Pricing
View Details