Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free Galectin-7/LGALS7, Human (His)

Galectin-7 (LGALS7), a protein with potential involvement in cell-cell and/or cell-matrix interactions crucial for normal growth control, serves as a pro-apoptotic factor. It functions intracellularly, playing a role upstream of JNK activation and cytochrome c release, thus contributing to apoptotic pathways. Galectin-7 exists as a monomer, highlighting its individual unit structure. Animal-Free Galectin-7/LGALS7 Protein, Human (His) is the recombinant human-derived animal-FreeGalectin-7/LGALS7 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free Galectin-7/LGALS7 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-galectin-7-lgals7-protein-human-his.html

Purity

98.0

Smiles

SNVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF

Molecular Formula

3963 (Gene_ID) P47929 (S2-F136) (Accession)

Molecular Weight

Approximately 15.9 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD10 (CB-CALLA), CF568 conjugate, 0.1mg/mL
BNC680146-100 1x 100 µL

CD10 (CB-CALLA), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF740 conjugate, 0.1mg/mL
BNC741050-100 1x 100 µL

CD3e (CRIS-7), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF740 conjugate, 0.1mg/mL
BNC740437-100 1x 100 µL

CD47 (B6H12.2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details