Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Growth/differentiation factor 9 (GDF9)

Product Specifications

Abbreviation

Recombinant Human GDF9 protein

Gene Name

GDF9

UniProt

O60383

Expression Region

320-454aa

Organism

Homo sapiens (Human)

Target Sequence

GQETVSSELKKPLGPASFNLSEYFRQFLLPQNECELHDFRLSFSQLKWDNWIVAPHRYNPRYCKGDCPRAVGHRYGSPVHTMVQNIIYEKLDSSVPRPSCVPAKYSPLSVLTIEPDGSIAYKEYEDMIATKCTCR

Tag

Tag-Free

Type

Developed Protein

Source

E.coli

Field of Research

Cardiovascular

Relevance

Required for ovarian folliculogenesis. Promotes primordial follicle development. Stimulates granulosa cell proliferation. Promotes cell transition from G0/G1 to S and G2/M phases, through an increase of CCND1 and CCNE1 expression, and RB1 phosphorylation. It regulates STAR expression and cAMP-dependent progesterone release in granulosa and thecal cells. Attenuates the suppressive effects of activin A on STAR expression and progesterone production by increasing the expression of inhibin B. It suppresses FST and FSTL3 production in granulosa-lutein cells.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

15.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Box of 500 Ptfe Syringe Filter 0.45µm, 13 Mm
SF13PT45D Box of 500

Box of 500 Ptfe Syringe Filter 0.45µm, 13 Mm

Sign In for Pricing
View Details
CTAGE15 Human Gene Knockout Kit (CRISPR)
KN407246 1 Kit

CTAGE15 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Lentiviral human TOMM7 sgRNA gene knockout kit - Lentiviral human TOMM7 sgRNA gene knockout kit (plasmid)
GTR15394700 1 Vial

Lentiviral human TOMM7 sgRNA gene knockout kit - Lentiviral human TOMM7 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
ETFDH Rabbit Polyclonal Antibody (APC-Cy7)
orb2527845 100 µL

ETFDH Rabbit Polyclonal Antibody (APC-Cy7)

Sign In for Pricing
View Details
Human secretory immunoglobulin A,SIgA ELISA Kit
CN-04129H2 48T

Human secretory immunoglobulin A,SIgA ELISA Kit

Sign In for Pricing
View Details
CD208 Rabbit Polyclonal Antibody
orb665591-01 30 µL

CD208 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details