Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transcriptional enhancer factor TEF-3 (Tead4), partial

Product Specifications

Product Name Alternative

ETF-related factor 2 (ETFR-2) (TEA domain family member 4) (TEAD-4) (TEF-1-related factor 1) (TEF-1-related factor FR-19) (RTEF-1)

Abbreviation

Recombinant Mouse Tead4 protein, partial

Gene Name

Tead4

UniProt

Q62296

Expression Region

210-427aa

Organism

Mus musculus (Mouse)

Target Sequence

RSIASSKLWMLEFSAFLERQQDPDTYNKHLFVHISQSSPSYSDPYLETVDIRQIYDKFPEKKGGLKELFERGPSNAFFLVKFWADLNTNIDDEGSAFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYLYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cardiovascular

Relevance

Transcription factor which plays a key role in the Hippo signaling pathway, a pathway involved in organ size control and tumor suppression by restricting proliferation and promoting apoptosis.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

33.0 kDa

References & Citations

"A novel family of developmentally regulated mammalian transcription factors containing the TEA/ATTS DNA binding domain." Jacquemin P., Hwang J.-J., Martial J.A., Dolle P., Davidson I. J. Biol. Chem. 271:21775-21785 (1996)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polystyrene A Br
HA50056001.100G 100 g

Polystyrene A Br

Sign In for Pricing
View Details
DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (DG1/2564R), Biotin conjugate, 0.1mg/mL
BNCB2564-100 1x 100 µL

DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (DG1/2564R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Uncoated Human SCCA1 (Squamous Cell Carcinoma Antigen 1) ELISA Kit
E-UNEL-H0231-01 5x 96 Tests

Uncoated Human SCCA1 (Squamous Cell Carcinoma Antigen 1) ELISA Kit

Sign In for Pricing
View Details
Uncoated Human SCCA1 (Squamous Cell Carcinoma Antigen 1) ELISA Kit
E-UNEL-H0231-02 15x 96 Tests

Uncoated Human SCCA1 (Squamous Cell Carcinoma Antigen 1) ELISA Kit

Sign In for Pricing
View Details
TCF4 Antibody: ATTO 488
SPC-723D-A488 100 µg

TCF4 Antibody: ATTO 488

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS713728 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details