Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSD17B14, Human (HEK293, His)

HSD17B14 protein, with NAD-dependent 17-beta-hydroxysteroid dehydrogenase activity, converts oestradiol to oestrone. Its enzymatic activity extends to both oestradiol and 5-androstene-3-beta,17-beta-diol in vitro, although the physiological substrate remains unidentified. HSD17B14 Protein, Human (HEK293, His) is the recombinant human-derived HSD17B14 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

HSD17B14 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hsd17b14-protein-human-hek293-his.html

Purity

97.00

Smiles

MATGTRYAGKVVVVTGGGRGIGAGIVRAFVNSGARVVICDKDESGGRALEQELPGAVFILCDVTQEDDVKTLVSETIRRFGRLDCVVNNAGHHPPPQRPEETSAQGFRQLLELNLLGTYTLTKLALPYLRKSQGNVINISSLVGAIGQAQAVPYVATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELAALMPDPRATIREGMLAQPLGRMGQPAEVGAAAVFLASEANFCTGIELLVTGGAELGYGCKASRSTPVDAPDIPS

Molecular Formula

51171 (Gene_ID) Q9BPX1/NP_057330.2 (M1-S270) (Accession)

Molecular Weight

Approximately 29.8 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Vimentin (VIM) ELISA Kit
RK14936 96 Tests

Rat Vimentin (VIM) ELISA Kit

Sign In for Pricing
View Details
Recombinant Pig NADH-cytochrome b5 reductase 3 (CYB5R3)
MBS950395-01 0.02 mg (E-Coli)

Recombinant Pig NADH-cytochrome b5 reductase 3 (CYB5R3)

Sign In for Pricing
View Details
Recombinant Pig NADH-cytochrome b5 reductase 3 (CYB5R3)
MBS950395-02 0.02 mg (Yeast)

Recombinant Pig NADH-cytochrome b5 reductase 3 (CYB5R3)

Sign In for Pricing
View Details
Recombinant Pig NADH-cytochrome b5 reductase 3 (CYB5R3)
MBS950395-03 0.1 mg (E-Coli)

Recombinant Pig NADH-cytochrome b5 reductase 3 (CYB5R3)

Sign In for Pricing
View Details
Recombinant Pig NADH-cytochrome b5 reductase 3 (CYB5R3)
MBS950395-04 0.1 mg (Yeast)

Recombinant Pig NADH-cytochrome b5 reductase 3 (CYB5R3)

Sign In for Pricing
View Details
Recombinant Pig NADH-cytochrome b5 reductase 3 (CYB5R3)
MBS950395-05 0.02 mg (Baculovirus)

Recombinant Pig NADH-cytochrome b5 reductase 3 (CYB5R3)

Sign In for Pricing
View Details