Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSD17B14, Human (HEK293, His)

HSD17B14 protein, with NAD-dependent 17-beta-hydroxysteroid dehydrogenase activity, converts oestradiol to oestrone. Its enzymatic activity extends to both oestradiol and 5-androstene-3-beta,17-beta-diol in vitro, although the physiological substrate remains unidentified. HSD17B14 Protein, Human (HEK293, His) is the recombinant human-derived HSD17B14 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

HSD17B14 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hsd17b14-protein-human-hek293-his.html

Purity

97.00

Smiles

MATGTRYAGKVVVVTGGGRGIGAGIVRAFVNSGARVVICDKDESGGRALEQELPGAVFILCDVTQEDDVKTLVSETIRRFGRLDCVVNNAGHHPPPQRPEETSAQGFRQLLELNLLGTYTLTKLALPYLRKSQGNVINISSLVGAIGQAQAVPYVATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELAALMPDPRATIREGMLAQPLGRMGQPAEVGAAAVFLASEANFCTGIELLVTGGAELGYGCKASRSTPVDAPDIPS

Molecular Formula

51171 (Gene_ID) Q9BPX1/NP_057330.2 (M1-S270) (Accession)

Molecular Weight

Approximately 29.8 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Epha5 (NM_007937) Mouse Tagged ORF Clone
MG226341 10 µg

Epha5 (NM_007937) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
KLF2 Antibody
MBS8595098-01 0.1 mg

KLF2 Antibody

Sign In for Pricing
View Details
KLF2 Antibody
MBS8595098-02 0.1 mL (AF405L)

KLF2 Antibody

Sign In for Pricing
View Details
KLF2 Antibody
MBS8595098-03 0.1 mL (AF405S)

KLF2 Antibody

Sign In for Pricing
View Details
KLF2 Antibody
MBS8595098-04 0.1 mL (AF610)

KLF2 Antibody

Sign In for Pricing
View Details
KLF2 Antibody
MBS8595098-05 0.1 mL (AF635)

KLF2 Antibody

Sign In for Pricing
View Details