Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSD17B14, Human (HEK293, His)

HSD17B14 protein, with NAD-dependent 17-beta-hydroxysteroid dehydrogenase activity, converts oestradiol to oestrone. Its enzymatic activity extends to both oestradiol and 5-androstene-3-beta,17-beta-diol in vitro, although the physiological substrate remains unidentified. HSD17B14 Protein, Human (HEK293, His) is the recombinant human-derived HSD17B14 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

HSD17B14 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hsd17b14-protein-human-hek293-his.html

Purity

97.00

Smiles

MATGTRYAGKVVVVTGGGRGIGAGIVRAFVNSGARVVICDKDESGGRALEQELPGAVFILCDVTQEDDVKTLVSETIRRFGRLDCVVNNAGHHPPPQRPEETSAQGFRQLLELNLLGTYTLTKLALPYLRKSQGNVINISSLVGAIGQAQAVPYVATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELAALMPDPRATIREGMLAQPLGRMGQPAEVGAAAVFLASEANFCTGIELLVTGGAELGYGCKASRSTPVDAPDIPS

Molecular Formula

51171 (Gene_ID) Q9BPX1/NP_057330.2 (M1-S270) (Accession)

Molecular Weight

Approximately 29.8 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD99L2 Protein Vector (Rat) (pPM-C-His)
PV258765 500 ng

CD99L2 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
ACAT1 (ACACA) Rabbit Monoclonal Antibody [Clone ID: RM232]
TA398452 100 µL

ACAT1 (ACACA) Rabbit Monoclonal Antibody [Clone ID: RM232]

Sign In for Pricing
View Details
WNT2 Recombinant Protein (Human)
RP034819 100 µg

WNT2 Recombinant Protein (Human)

Sign In for Pricing
View Details
Recombinant Mouse RNF5 Protein, His (Fc)-Avi-tagged
RNF5-7688M 50 µg

Recombinant Mouse RNF5 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
AI987944 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K4991608 1.0 µg DNA

AI987944 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Nfkbib sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3988808 1.0 µg DNA

Nfkbib sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details