Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSD17B14, Human (HEK293, His)

HSD17B14 protein, with NAD-dependent 17-beta-hydroxysteroid dehydrogenase activity, converts oestradiol to oestrone. Its enzymatic activity extends to both oestradiol and 5-androstene-3-beta,17-beta-diol in vitro, although the physiological substrate remains unidentified. HSD17B14 Protein, Human (HEK293, His) is the recombinant human-derived HSD17B14 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

HSD17B14 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hsd17b14-protein-human-hek293-his.html

Purity

97.00

Smiles

MATGTRYAGKVVVVTGGGRGIGAGIVRAFVNSGARVVICDKDESGGRALEQELPGAVFILCDVTQEDDVKTLVSETIRRFGRLDCVVNNAGHHPPPQRPEETSAQGFRQLLELNLLGTYTLTKLALPYLRKSQGNVINISSLVGAIGQAQAVPYVATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELAALMPDPRATIREGMLAQPLGRMGQPAEVGAAAVFLASEANFCTGIELLVTGGAELGYGCKASRSTPVDAPDIPS

Molecular Formula

51171 (Gene_ID) Q9BPX1/NP_057330.2 (M1-S270) (Accession)

Molecular Weight

Approximately 29.8 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Lysine-Ketoglutarate Reductase ELISA Kit
MBS3809875-01 48 Well

Rat Lysine-Ketoglutarate Reductase ELISA Kit

Sign In for Pricing
View Details
Rat Lysine-Ketoglutarate Reductase ELISA Kit
MBS3809875-02 96 Well

Rat Lysine-Ketoglutarate Reductase ELISA Kit

Sign In for Pricing
View Details
Rat Lysine-Ketoglutarate Reductase ELISA Kit
MBS3809875-03 5x 96 Well

Rat Lysine-Ketoglutarate Reductase ELISA Kit

Sign In for Pricing
View Details
Rat Lysine-Ketoglutarate Reductase ELISA Kit
MBS3809875-04 10x 96 Well

Rat Lysine-Ketoglutarate Reductase ELISA Kit

Sign In for Pricing
View Details
SNAI3 Polyclonal Antibody
JOT-AP14336-01 50ul

SNAI3 Polyclonal Antibody

Sign In for Pricing
View Details
SNAI3 Polyclonal Antibody
JOT-AP14336-02 100ul

SNAI3 Polyclonal Antibody

Sign In for Pricing
View Details