Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free Galectin-10, Human (His)

Galectin-10 Protein, pivotal in immune regulation, recognizes cell-surface glycans, inducing anergy and suppressing CD25-positive regulatory T-cells (Treg) . Interacting with CEL, it modulates immune responses, highlighting its significance in orchestrating immunoregulatory cellular processes. Animal-Free Galectin-10 Protein, Human (His) is the recombinant human-derived animal-FreeGalectin-10 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free Galectin-10 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-galectin-10-protein-human-his.html

Purity

98.0

Smiles

SLLPVPYTEAASLSTGSTVTIKGRPLACFLNEPYLQVDFHTEMKEESDIVFHFQVCFGRRVVMNSREYGAWKQQVESKNMPFQDGQEFELSISVLPDKYQVMVNGQSSYTFDHRIKPEAVKMVQVWRDISLTKFNVSYLKR

Molecular Formula

1178 (Gene_ID) Q05315 (S2-R142) (Accession)

Molecular Weight

Approximately 36.7 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNF114, 1-228aa Human, His tag, E.coli
E53A03751 50 µg

RNF114, 1-228aa Human, His tag, E.coli

Sign In for Pricing
View Details
TLR8 Rat Monoclonal Antibody [Clone ID: 103E11.01]
DDX0482A488-100 100 µg

TLR8 Rat Monoclonal Antibody [Clone ID: 103E11.01]

Sign In for Pricing
View Details
Recombinant Human CD274 Protein
CD274-25H 50 µg

Recombinant Human CD274 Protein

Sign In for Pricing
View Details
Human KIT Ligand (KITLG; SCF) ELISA Kit
YP-W10158-01 48 Tests

Human KIT Ligand (KITLG; SCF) ELISA Kit

Sign In for Pricing
View Details
Human KIT Ligand (KITLG; SCF) ELISA Kit
YP-W10158-02 96 Tests

Human KIT Ligand (KITLG; SCF) ELISA Kit

Sign In for Pricing
View Details
NOXA1 Protein Vector (Mouse) (pPM-C-His)
PV206193 500 ng

NOXA1 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details