Animal-Free Galectin-10, Human (His)
Galectin-10 Protein, pivotal in immune regulation, recognizes cell-surface glycans, inducing anergy and suppressing CD25-positive regulatory T-cells (Treg) . Interacting with CEL, it modulates immune responses, highlighting its significance in orchestrating immunoregulatory cellular processes. Animal-Free Galectin-10 Protein, Human (His) is the recombinant human-derived animal-FreeGalectin-10 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.
Product Specifications
Product Name Alternative
Animal-Free Galectin-10 Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/animal-free-galectin-10-protein-human-his.html
Purity
98.0
Smiles
SLLPVPYTEAASLSTGSTVTIKGRPLACFLNEPYLQVDFHTEMKEESDIVFHFQVCFGRRVVMNSREYGAWKQQVESKNMPFQDGQEFELSISVLPDKYQVMVNGQSSYTFDHRIKPEAVKMVQVWRDISLTKFNVSYLKR
Molecular Formula
1178 (Gene_ID) Q05315 (S2-R142) (Accession)
Molecular Weight
Approximately 36.7 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
KHNYN, CT (KHNYN, KIAA0323, Protein KHNYN, KH and NYN domain-containing protein) (Biotin)
KHNYN, CT (KHNYN, KIAA0323, Protein KHNYN, KH and NYN domain-containing protein) (Biotin)
TECK (CCL25) rabbit polyclonal antibody, Aff - Purified
Recombinant Magnaporthe oryzae Protein FYV10 (FYV10)
Recombinant Magnaporthe oryzae Protein FYV10 (FYV10)