Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free Galectin-10, Human (His)

Galectin-10 Protein, pivotal in immune regulation, recognizes cell-surface glycans, inducing anergy and suppressing CD25-positive regulatory T-cells (Treg) . Interacting with CEL, it modulates immune responses, highlighting its significance in orchestrating immunoregulatory cellular processes. Animal-Free Galectin-10 Protein, Human (His) is the recombinant human-derived animal-FreeGalectin-10 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free Galectin-10 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-galectin-10-protein-human-his.html

Purity

98.0

Smiles

SLLPVPYTEAASLSTGSTVTIKGRPLACFLNEPYLQVDFHTEMKEESDIVFHFQVCFGRRVVMNSREYGAWKQQVESKNMPFQDGQEFELSISVLPDKYQVMVNGQSSYTFDHRIKPEAVKMVQVWRDISLTKFNVSYLKR

Molecular Formula

1178 (Gene_ID) Q05315 (S2-R142) (Accession)

Molecular Weight

Approximately 36.7 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXF1 (Forkhead Box Protein F1, Forkhead-related Activator 1, FREAC-1, Forkhead-related Protein FKHL5, Forkhead-related Transcription Factor 1, FKHL5, FREAC1) (Biotin)
126944-Biotin 100 µL

FOXF1 (Forkhead Box Protein F1, Forkhead-related Activator 1, FREAC-1, Forkhead-related Protein FKHL5, Forkhead-related Transcription Factor 1, FKHL5, FREAC1) (Biotin)

Sign In for Pricing
View Details
Osbpl1a Mouse shRNA Plasmid (Locus ID 64291)
TL503456 1 Kit

Osbpl1a Mouse shRNA Plasmid (Locus ID 64291)

Sign In for Pricing
View Details
Trans-4-[2-[4- (2,3-Dichlorophenyl) piperazin-1-yl]ethyl]cyclohexanamine
467861-01 10 mg

Trans-4-[2-[4- (2,3-Dichlorophenyl) piperazin-1-yl]ethyl]cyclohexanamine

Sign In for Pricing
View Details
Trans-4-[2-[4- (2,3-Dichlorophenyl) piperazin-1-yl]ethyl]cyclohexanamine
467861-02 50 mg

Trans-4-[2-[4- (2,3-Dichlorophenyl) piperazin-1-yl]ethyl]cyclohexanamine

Sign In for Pricing
View Details
Recombinant Mouse Uteroglobin/SCGB1A1 Protein (His Tag)
PKSM040754 100 µg

Recombinant Mouse Uteroglobin/SCGB1A1 Protein (His Tag)

Sign In for Pricing
View Details
DDAH1, CT (N (G), N (G) -dimethylarginine Dimethylaminohydrolase 1, Dimethylarginine Dimethylaminohydrolase 1, DDAH-1, DDAHI, Dimethylargininase-1, DDAH) (MaxLight 405) discontinued
D1559-95A-ML405 100 µL

DDAH1, CT (N (G), N (G) -dimethylarginine Dimethylaminohydrolase 1, Dimethylarginine Dimethylaminohydrolase 1, DDAH-1, DDAHI, Dimethylargininase-1, DDAH) (MaxLight 405) discontinued

Sign In for Pricing
View Details