Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free Galectin-10, Human (His)

Galectin-10 Protein, pivotal in immune regulation, recognizes cell-surface glycans, inducing anergy and suppressing CD25-positive regulatory T-cells (Treg) . Interacting with CEL, it modulates immune responses, highlighting its significance in orchestrating immunoregulatory cellular processes. Animal-Free Galectin-10 Protein, Human (His) is the recombinant human-derived animal-FreeGalectin-10 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free Galectin-10 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-galectin-10-protein-human-his.html

Purity

98.0

Smiles

SLLPVPYTEAASLSTGSTVTIKGRPLACFLNEPYLQVDFHTEMKEESDIVFHFQVCFGRRVVMNSREYGAWKQQVESKNMPFQDGQEFELSISVLPDKYQVMVNGQSSYTFDHRIKPEAVKMVQVWRDISLTKFNVSYLKR

Molecular Formula

1178 (Gene_ID) Q05315 (S2-R142) (Accession)

Molecular Weight

Approximately 36.7 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

[KO Validated] CD34 polyclonal antibody
BS80505-01 50 µL

[KO Validated] CD34 polyclonal antibody

Sign In for Pricing
View Details
[KO Validated] CD34 polyclonal antibody
BS80505-02 100 µL

[KO Validated] CD34 polyclonal antibody

Sign In for Pricing
View Details
6-AB-ADP
BLG-A026-05 5 μmoL

6-AB-ADP

Sign In for Pricing
View Details
NP-1 (alpha Defensin-1) (MaxLight 550)
N5377-01-ML550 100 µL

NP-1 (alpha Defensin-1) (MaxLight 550)

Sign In for Pricing
View Details
PTRHD1 sgRNA CRISPR Lentivector (Human) (Target 3)
K2798104 1.0 µg DNA

PTRHD1 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
MRFAP1 Rabbit pAb (APR28424N)
APR28424N-01 50 µL

MRFAP1 Rabbit pAb (APR28424N)

Sign In for Pricing
View Details