Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free Galectin-10, Human (His)

Galectin-10 Protein, pivotal in immune regulation, recognizes cell-surface glycans, inducing anergy and suppressing CD25-positive regulatory T-cells (Treg) . Interacting with CEL, it modulates immune responses, highlighting its significance in orchestrating immunoregulatory cellular processes. Animal-Free Galectin-10 Protein, Human (His) is the recombinant human-derived animal-FreeGalectin-10 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free Galectin-10 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-galectin-10-protein-human-his.html

Purity

98.0

Smiles

SLLPVPYTEAASLSTGSTVTIKGRPLACFLNEPYLQVDFHTEMKEESDIVFHFQVCFGRRVVMNSREYGAWKQQVESKNMPFQDGQEFELSISVLPDKYQVMVNGQSSYTFDHRIKPEAVKMVQVWRDISLTKFNVSYLKR

Molecular Formula

1178 (Gene_ID) Q05315 (S2-R142) (Accession)

Molecular Weight

Approximately 36.7 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-DENND4A antibody
SL14272R-01 50 µL

Rabbit Anti-DENND4A antibody

Sign In for Pricing
View Details
Rabbit Anti-DENND4A antibody
SL14272R-02 100 µL

Rabbit Anti-DENND4A antibody

Sign In for Pricing
View Details
Tollip sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K7612507 1.0 µg DNA

Tollip sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Rabbit Polyclonal TIP120B Antibody [DyLight 488]
NBP2-22334G 0.1 mL

Rabbit Polyclonal TIP120B Antibody [DyLight 488]

Sign In for Pricing
View Details
Mouse Glutaminyl-peptide cyclotransferase ELISA Kit
MBS2886642-01 48 Well

Mouse Glutaminyl-peptide cyclotransferase ELISA Kit

Sign In for Pricing
View Details
Mouse Glutaminyl-peptide cyclotransferase ELISA Kit
MBS2886642-02 96 Well

Mouse Glutaminyl-peptide cyclotransferase ELISA Kit

Sign In for Pricing
View Details