Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free Galectin-10, Human (His)

Galectin-10 Protein, pivotal in immune regulation, recognizes cell-surface glycans, inducing anergy and suppressing CD25-positive regulatory T-cells (Treg) . Interacting with CEL, it modulates immune responses, highlighting its significance in orchestrating immunoregulatory cellular processes. Animal-Free Galectin-10 Protein, Human (His) is the recombinant human-derived animal-FreeGalectin-10 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free Galectin-10 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-galectin-10-protein-human-his.html

Purity

98.0

Smiles

SLLPVPYTEAASLSTGSTVTIKGRPLACFLNEPYLQVDFHTEMKEESDIVFHFQVCFGRRVVMNSREYGAWKQQVESKNMPFQDGQEFELSISVLPDKYQVMVNGQSSYTFDHRIKPEAVKMVQVWRDISLTKFNVSYLKR

Molecular Formula

1178 (Gene_ID) Q05315 (S2-R142) (Accession)

Molecular Weight

Approximately 36.7 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Forkhead box protein J1, Foxj1 ELISA KIT
ELI-47319m 96 Tests

Mouse Forkhead box protein J1, Foxj1 ELISA KIT

Sign In for Pricing
View Details
TPRKB Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV690693 1.0 µg DNA

TPRKB Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Mouse C57 Hypothalamus cDNA
MD-204-C57 30 Reactions

Mouse C57 Hypothalamus cDNA

Sign In for Pricing
View Details
Actba Antibody
abx319956-01 20 µg

Actba Antibody

Sign In for Pricing
View Details
Actba Antibody
abx319956-02 50 µg

Actba Antibody

Sign In for Pricing
View Details
Actba Antibody
abx319956-03 100 µg

Actba Antibody

Sign In for Pricing
View Details