Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dog Interleukin-33 (IL33), partial

Product Specifications

Product Name Alternative

(IL-33) (Protein DVS27)

Abbreviation

Recombinant Dog IL33 protein, partial

Gene Name

IL33

UniProt

O97863

Expression Region

102-263aa

Organism

Canis lupus familiaris (Dog) (Canis familiaris)

Target Sequence

CFGRANVPSIQEYSASLSTYNDQSITFVFEDGSYEIYVEDLRKGQEKDKVLFRYYDSQSPSHETGDDVDGQTLLVNLSPTKDKDFLLHANNEEHSVELQKCENQLPDQAFFLLHRKSSECVSFECKNNPGVFIGVKDNHLALIKVGDQTKDSYIEKTIFKLS

Tag

N-terminal 10xHis-tagged

Type

In Stock Protein

Source

Mammalian cell

Field of Research

Cardiovascular

Relevance

Cytokine that binds to and signals through the IL1RL1/ST2 receptor which in turn activates NF-kappa-B and MAPK signaling pathways in target cells. Involved in the maturation of Th2 cells inducing the secretion of T-helper type 2-associated cytokines. Also involved in activation of mast cells, basophils, eosinophils and natural killer cells. Acts as a chemoattractant for Th2 cells, and may function as an 'alarmin', that amplifies immune responses during tissue injury.; In quiescent endothelia the uncleaved form is constitutively and abundantly expressed, and acts as a chromatin-associated nuclear factor with transcriptional repressor properties, it may sequester nuclear NF-kappaB/RELA, lowering expression of its targets. This form is rapidely lost upon angiogenic or proinflammatory activation.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

22.1 kDa

References & Citations

"Identification of genes differentially expressed in canine vasospastic cerebral arteries after subarachnoid hemorrhage." Onda H., Kasuya H., Takakura K., Hori T., Imaizumi T., Takeuchi T., Inoue I., Takeda J. J. Cereb. Blood Flow Metab. 19:1279-1288 (1999)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(S)-(-)-Canadine
TRC-C175180-25MG 25 mg

(S)-(-)-Canadine

Sign In for Pricing
View Details
Transfer Pipettes
P4114-00 250 Units/Pack

Transfer Pipettes

Sign In for Pricing
View Details
BUB1 (NM_004336) Human Over-expression Lysate
LC401381 20 µg

BUB1 (NM_004336) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Galectin 3 (GAL3) ELISA Kit
RDR-GAL3-Mu-01 96 Tests

Mouse Galectin 3 (GAL3) ELISA Kit

Sign In for Pricing
View Details
Mouse Galectin 3 (GAL3) ELISA Kit
RDR-GAL3-Mu-02 48 Tests

Mouse Galectin 3 (GAL3) ELISA Kit

Sign In for Pricing
View Details
VISTA / GI24 (Negative Regulator of Immune Response) (VISTA/3006), 0.2mg/mL
BNUB3006-100 1x 100 µL

VISTA / GI24 (Negative Regulator of Immune Response) (VISTA/3006), 0.2mg/mL

Sign In for Pricing
View Details