Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GLP1R, Mouse (His-SUMO)

GLP1R protein, a G-protein coupled receptor, binds to GLP-1, activating adenylyl cyclase and increasing intracellular cAMP levels. This interaction regulates insulin secretion and maintains glucose homeostasis. GLP1R can also form dimers with GIPR, suggesting complex regulatory mechanisms and interactions with other receptors. GLP1R Protein, Mouse (His-SUMO) is the recombinant mouse-derived GLP1R protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

GLP1R Protein, Mouse (His-SUMO), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/glp1r-protein-mouse-his-sumo.html

Purity

91.00

Smiles

GPRPQGTTVSLSETVQKWREYRRQCQRFLTEAPLLATGLFCNRTFDDYACWPDGPPGSFVNVSCPWYLPWASSVLQGHVYRFCTAEGLWLHKDNSSLPWRDLSECEESKRGERNFPEEQLLSLY

Molecular Formula

14652 (Gene_ID) O35659 (G22-Y145) (Accession)

Molecular Weight

Approximately 30.4 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tyrosinase (T311), CF647 conjugate, 0.1mg/mL
BNC470012-100 1x 100 µL

Tyrosinase (T311), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF594 conjugate, 0.1mg/mL
BNC940391-500 1x 500 µL

CD81 / TAPA-1 (1.3.3.22), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF405M conjugate, 0.1mg/mL
BNC050391-500 1x 500 µL

CD81 / TAPA-1 (1.3.3.22), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF568 conjugate, 0.1mg/mL
BNC680017-500 1x 500 µL

Ep-CAM / CD326 (VU-1D9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GAD1 / GAD67 (GABAergic Neuronal Marker) (GAD1/2563), CF640R conjugate, 0.1mg/mL
BNC402563-100 1x 100 µL

GAD1 / GAD67 (GABAergic Neuronal Marker) (GAD1/2563), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (HSPD1/780), CF594 conjugate, 0.1mg/mL
BNC940780-100 1x 100 µL

HSP60 (HSPD1/780), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details