Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100B, Human (His)

The S100B protein binds calcium and zinc ions, each with a different site on the monomer. Physiological levels of potassium ions disrupt the binding of calcium and zinc, affecting high-affinity sites. S100B Protein, Human (His) is the recombinant human-derived S100B protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

S100B Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/s100b-protein-human-his.html

Purity

98.0

Smiles

MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE

Molecular Formula

6285 (Gene_ID) P04271 (M1-E92) (Accession)

Molecular Weight

Approximately 12.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TPRN siRNA (Mouse)
orb1838934-01 15 nmol

TPRN siRNA (Mouse)

Sign In for Pricing
View Details
TPRN siRNA (Mouse)
orb1838934-02 30 nmol

TPRN siRNA (Mouse)

Sign In for Pricing
View Details
SM22 Alpha Rabbit Polyclonal Antibody (RBITC)
orb1050079 100 µL

SM22 Alpha Rabbit Polyclonal Antibody (RBITC)

Sign In for Pricing
View Details
MMP-13 (catalytic domain) (human), (recombinant)
BML-SE246-0010 10 µg

MMP-13 (catalytic domain) (human), (recombinant)

Sign In for Pricing
View Details
NPT2C, NT (SLC34A3, NPT2C, NPTIIC, Sodium-dependent phosphate transport protein 2C, Na (+) -dependent phosphate cotransporter 2C, Sodium/inorganic phosphate cotransporter IIC, Sodium/phosphate cotransporter 2C, Solute carrier family 34 member 3) (MaxLight 650) discontinued
039101-ML650 100 µL

NPT2C, NT (SLC34A3, NPT2C, NPTIIC, Sodium-dependent phosphate transport protein 2C, Na (+) -dependent phosphate cotransporter 2C, Sodium/inorganic phosphate cotransporter IIC, Sodium/phosphate cotransporter 2C, Solute carrier family 34 member 3) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Caprisil C8-TH HPLC Column, 5 µm, 100 Å, CY553-C8-TH x 75 mm
CY253-C8-TH 5 µm

Caprisil C8-TH HPLC Column, 5 µm, 100 Å, CY553-C8-TH x 75 mm

Sign In for Pricing
View Details