Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100B, Human (His)

The S100B protein binds calcium and zinc ions, each with a different site on the monomer. Physiological levels of potassium ions disrupt the binding of calcium and zinc, affecting high-affinity sites. S100B Protein, Human (His) is the recombinant human-derived S100B protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

S100B Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/s100b-protein-human-his.html

Purity

98.0

Smiles

MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE

Molecular Formula

6285 (Gene_ID) P04271 (M1-E92) (Accession)

Molecular Weight

Approximately 12.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gag-p24 Protein (C-His, HIV)
P519956 100 µg

Gag-p24 Protein (C-His, HIV)

Sign In for Pricing
View Details
SNRPA Antibody, Biotin conjugated
CSB-PA00974D0Rb-01 50 µg

SNRPA Antibody, Biotin conjugated

Sign In for Pricing
View Details
SNRPA Antibody, Biotin conjugated
CSB-PA00974D0Rb-02 100 µg

SNRPA Antibody, Biotin conjugated

Sign In for Pricing
View Details
BIRC5 Antibody / Survivin
V5736SAF-100UG 100 µg

BIRC5 Antibody / Survivin

Sign In for Pricing
View Details
SCAF8 (Protein SCAF8, CDC5L Complex-Associated Protein 7, RNA-Binding Motif Protein 16, SR-Related and CTD-Associated Factor 8, SCAF8, CCAP7, KIAA1116, RBM16) (MaxLight 490)
MBS6459094-01 0.1 mL

SCAF8 (Protein SCAF8, CDC5L Complex-Associated Protein 7, RNA-Binding Motif Protein 16, SR-Related and CTD-Associated Factor 8, SCAF8, CCAP7, KIAA1116, RBM16) (MaxLight 490)

Sign In for Pricing
View Details
SCAF8 (Protein SCAF8, CDC5L Complex-Associated Protein 7, RNA-Binding Motif Protein 16, SR-Related and CTD-Associated Factor 8, SCAF8, CCAP7, KIAA1116, RBM16) (MaxLight 490)
MBS6459094-02 5x 0.1 mL

SCAF8 (Protein SCAF8, CDC5L Complex-Associated Protein 7, RNA-Binding Motif Protein 16, SR-Related and CTD-Associated Factor 8, SCAF8, CCAP7, KIAA1116, RBM16) (MaxLight 490)

Sign In for Pricing
View Details