Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human COMM domain-containing protein 4 (COMMD4), partial

Product Specifications

Product Name Alternative

COMD4_HUMAN; COMM domain containing 4; COMM domain-containing protein 4; COMMD4

Abbreviation

Recombinant Human COMMD4 protein, partial

Gene Name

COMMD4

UniProt

Q9H0A8

Expression Region

1-195aa

Organism

Homo sapiens (Human)

Target Sequence

MRFRFCGDLDCPDWVLAEISTLAKMSSVKLRLLCSQVLKELLGQGIDYEKILKLTADAKFESGDVKATVAVLSFILSSAAKHSVDGESLSSELQQLGLPKEHAASLCRCYEEKQSPLQKHLRVCSLRMNRLAGVGWRVDYTLSSSLLQSVEEPMVHLRLEVAAAPGTPAQPVAMSLSADKFQVLLAELKQAQTLM

Tag

N-terminal GST-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cell Biology

Relevance

May modulate activity of cullin-RING E3 ubiquitin ligase (CRL) complexes . Down-regulates activation of NF-kappa-B.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

May modulate activity of cullin-RING E3 ubiquitin ligase (CRL) complexes

Molecular Weight

48.4 kDa

References & Citations

COMMD proteins, a novel family of structural and functional homologs of MURR1.Burstein E., Hoberg J.E., Wilkinson A.S., Rumble J.M., Csomos R.A., Komarck C.M., Maine G.N., Wilkinson J.C., Mayo M.W., Duckett C.S.J. Biol. Chem. 280:22222-22232 (2005)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tgoln2-set siRNA/shRNA/RNAi Lentivector (Mouse)
46618094 4x 500 ng

Tgoln2-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
Anti-Hu CD279 FITC
MBS1800577-01 100 Tests

Anti-Hu CD279 FITC

Sign In for Pricing
View Details
Anti-Hu CD279 FITC
MBS1800577-02 5x 100 Tests

Anti-Hu CD279 FITC

Sign In for Pricing
View Details
POU2F2 Antibody (N-term) [APR31165G]
APR31165G-01 50 µL

POU2F2 Antibody (N-term) [APR31165G]

Sign In for Pricing
View Details
POU2F2 Antibody (N-term) [APR31165G]
APR31165G-02 100 µL

POU2F2 Antibody (N-term) [APR31165G]

Sign In for Pricing
View Details
POU2F2 Antibody (N-term) [APR31165G]
APR31165G-03 200 µL

POU2F2 Antibody (N-term) [APR31165G]

Sign In for Pricing
View Details