Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBP7, Human (His)

RBP7 protein, a member of the CRBP family, is involved in the stability and metabolism of vitamin A. It binds to all-trans-retinol but with lower affinity compared to other CRBPs. RBP7 protein is expressed in fat, spleen, and other tissues, indicating possible tissue-specific functions. RBP7 Protein, Human (His) is the recombinant human-derived RBP7 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

RBP7 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rbp7-protein-human-his.html

Purity

95.0

Smiles

PADLSGTWTLLSSDNFEGYMLALGIDFATRKIAKLLKPQKVIEQNGDSFTIHTNSSLRNYFVKFKVGEEFDEDNRGLDNRKCKSLVIWDNDRLTCIQKGEKKNRGWTHWIEGDKLHLEMFCEGQVCKQTFQRA

Molecular Formula

116362 (Gene_ID) Q96R05/NP_443192.1 (P2-A134) (Accession)

Molecular Weight

Approximately 16 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTPN5 (NM_006906) Human Tagged Lenti ORF Clone
RC208953L3 10 µg

PTPN5 (NM_006906) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant Bovine RELT-like protein 1 (RELL1), partial
MBS7071660 Inquire

Recombinant Bovine RELT-like protein 1 (RELL1), partial

Sign In for Pricing
View Details
Purified recombinant Human FDCSP protein (His tag)
MBS5308643-01 0.1 mg

Purified recombinant Human FDCSP protein (His tag)

Sign In for Pricing
View Details
Purified recombinant Human FDCSP protein (His tag)
MBS5308643-02 5x 0.1 mg

Purified recombinant Human FDCSP protein (His tag)

Sign In for Pricing
View Details
B4GALT2 antibody - middle region
MBS3207406-01 0.1 mL

B4GALT2 antibody - middle region

Sign In for Pricing
View Details
B4GALT2 antibody - middle region
MBS3207406-02 5x 0.1 mL

B4GALT2 antibody - middle region

Sign In for Pricing
View Details