RBP7, Human (His)
RBP7 protein, a member of the CRBP family, is involved in the stability and metabolism of vitamin A. It binds to all-trans-retinol but with lower affinity compared to other CRBPs. RBP7 protein is expressed in fat, spleen, and other tissues, indicating possible tissue-specific functions. RBP7 Protein, Human (His) is the recombinant human-derived RBP7 protein, expressed by E. coli , with N-6*His labeled tag.
Product Specifications
Product Name Alternative
RBP7 Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/rbp7-protein-human-his.html
Purity
95.0
Smiles
PADLSGTWTLLSSDNFEGYMLALGIDFATRKIAKLLKPQKVIEQNGDSFTIHTNSSLRNYFVKFKVGEEFDEDNRGLDNRKCKSLVIWDNDRLTCIQKGEKKNRGWTHWIEGDKLHLEMFCEGQVCKQTFQRA
Molecular Formula
116362 (Gene_ID) Q96R05/NP_443192.1 (P2-A134) (Accession)
Molecular Weight
Approximately 16 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
![ENOX2, NT (ENOX2, COVA1, Ecto-NOX disulfide-thiol exchanger 2, APK1 antigen, Cytosolic ovarian carcinoma antigen 1, Tumor-associated hydroquinone oxidase, Hydroquinone [NADH] oxidase, Protein disulfide-thiol oxidoreductase) (MaxLight 750)](https://cdn.genprice.uk/genprice/uk/genprice5.webp)
ENOX2, NT (ENOX2, COVA1, Ecto-NOX disulfide-thiol exchanger 2, APK1 antigen, Cytosolic ovarian carcinoma antigen 1, Tumor-associated hydroquinone oxidase, Hydroquinone [NADH] oxidase, Protein disulfide-thiol oxidoreductase) (MaxLight 750)
ENOX2, NT (ENOX2, COVA1, Ecto-NOX disulfide-thiol exchanger 2, APK1 antigen, Cytosolic ovarian carcinoma antigen 1, Tumor-associated hydroquinone oxidase, Hydroquinone [NADH] oxidase, Protein disulfide-thiol oxidoreductase) (MaxLight 750)
