RBP7, Human (His)
RBP7 protein, a member of the CRBP family, is involved in the stability and metabolism of vitamin A. It binds to all-trans-retinol but with lower affinity compared to other CRBPs. RBP7 protein is expressed in fat, spleen, and other tissues, indicating possible tissue-specific functions. RBP7 Protein, Human (His) is the recombinant human-derived RBP7 protein, expressed by E. coli , with N-6*His labeled tag.
Product Specifications
Product Name Alternative
RBP7 Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/rbp7-protein-human-his.html
Purity
95.0
Smiles
PADLSGTWTLLSSDNFEGYMLALGIDFATRKIAKLLKPQKVIEQNGDSFTIHTNSSLRNYFVKFKVGEEFDEDNRGLDNRKCKSLVIWDNDRLTCIQKGEKKNRGWTHWIEGDKLHLEMFCEGQVCKQTFQRA
Molecular Formula
116362 (Gene_ID) Q96R05/NP_443192.1 (P2-A134) (Accession)
Molecular Weight
Approximately 16 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
2700094F01Rik (BC052187) Mouse Tagged Lenti ORF Clone
Tead3 sgRNA CRISPR Lentivector (Rat) (Target 3)
Camel Double C2-Like Domain-Containing Protein Beta (DOC2B) ELISA Kit
Camel Double C2-Like Domain-Containing Protein Beta (DOC2B) ELISA Kit
Camel Double C2-Like Domain-Containing Protein Beta (DOC2B) ELISA Kit