Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBP7, Human (His)

RBP7 protein, a member of the CRBP family, is involved in the stability and metabolism of vitamin A. It binds to all-trans-retinol but with lower affinity compared to other CRBPs. RBP7 protein is expressed in fat, spleen, and other tissues, indicating possible tissue-specific functions. RBP7 Protein, Human (His) is the recombinant human-derived RBP7 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

RBP7 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rbp7-protein-human-his.html

Purity

95.0

Smiles

PADLSGTWTLLSSDNFEGYMLALGIDFATRKIAKLLKPQKVIEQNGDSFTIHTNSSLRNYFVKFKVGEEFDEDNRGLDNRKCKSLVIWDNDRLTCIQKGEKKNRGWTHWIEGDKLHLEMFCEGQVCKQTFQRA

Molecular Formula

116362 (Gene_ID) Q96R05/NP_443192.1 (P2-A134) (Accession)

Molecular Weight

Approximately 16 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRPL44 sgRNA CRISPR Lentivector (Human) (Target 2)
K1330903 1.0 µg DNA

MRPL44 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Gm8817 3'UTR Luciferase Stable Cell Line
TU108706 1.0 mL

Gm8817 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Rabbit anti-Beta-2 Adrenergic Receptor Antibody
MBS4505776-01 0.05 mL

Rabbit anti-Beta-2 Adrenergic Receptor Antibody

Sign In for Pricing
View Details
Rabbit anti-Beta-2 Adrenergic Receptor Antibody
MBS4505776-02 0.1 mL

Rabbit anti-Beta-2 Adrenergic Receptor Antibody

Sign In for Pricing
View Details
Rabbit anti-Beta-2 Adrenergic Receptor Antibody
MBS4505776-03 5x 0.1 mL

Rabbit anti-Beta-2 Adrenergic Receptor Antibody

Sign In for Pricing
View Details
Recombinant Pasteurella Multocida msrB Protein (aa 1-130)
VAng-Cr6976-500gEcoli 500 µg (E. coli)

Recombinant Pasteurella Multocida msrB Protein (aa 1-130)

Sign In for Pricing
View Details