Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBP7, Human (His)

RBP7 protein, a member of the CRBP family, is involved in the stability and metabolism of vitamin A. It binds to all-trans-retinol but with lower affinity compared to other CRBPs. RBP7 protein is expressed in fat, spleen, and other tissues, indicating possible tissue-specific functions. RBP7 Protein, Human (His) is the recombinant human-derived RBP7 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

RBP7 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rbp7-protein-human-his.html

Purity

95.0

Smiles

PADLSGTWTLLSSDNFEGYMLALGIDFATRKIAKLLKPQKVIEQNGDSFTIHTNSSLRNYFVKFKVGEEFDEDNRGLDNRKCKSLVIWDNDRLTCIQKGEKKNRGWTHWIEGDKLHLEMFCEGQVCKQTFQRA

Molecular Formula

116362 (Gene_ID) Q96R05/NP_443192.1 (P2-A134) (Accession)

Molecular Weight

Approximately 16 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Krtap4-16 Protein Vector (Mouse) (pPB-C-His)
PV195530 500 ng

Krtap4-16 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Human Monoclonal Sortilin Antibody (latozinemab) [CoraFluor 1]
NBP3-28314CL1 0.1 mL

Human Monoclonal Sortilin Antibody (latozinemab) [CoraFluor 1]

Sign In for Pricing
View Details
SPINT4 Human Gene Knockout Kit (CRISPR)
KN422419 1 Kit

SPINT4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TRAJ33 3'UTR Lenti-reporter-Luc Vector
47468081 1.0 µg

TRAJ33 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Gelatin Embedding Capsules, Size 1 (19.0mm long x 6.63mm wide; .50ml volume)
07347-1000 1000 Capsules

Gelatin Embedding Capsules, Size 1 (19.0mm long x 6.63mm wide; .50ml volume)

Sign In for Pricing
View Details
TGM2 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
46611154 3x 1.0 µg DNA

TGM2 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details