Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBP7, Human (His)

RBP7 protein, a member of the CRBP family, is involved in the stability and metabolism of vitamin A. It binds to all-trans-retinol but with lower affinity compared to other CRBPs. RBP7 protein is expressed in fat, spleen, and other tissues, indicating possible tissue-specific functions. RBP7 Protein, Human (His) is the recombinant human-derived RBP7 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

RBP7 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rbp7-protein-human-his.html

Purity

95.0

Smiles

PADLSGTWTLLSSDNFEGYMLALGIDFATRKIAKLLKPQKVIEQNGDSFTIHTNSSLRNYFVKFKVGEEFDEDNRGLDNRKCKSLVIWDNDRLTCIQKGEKKNRGWTHWIEGDKLHLEMFCEGQVCKQTFQRA

Molecular Formula

116362 (Gene_ID) Q96R05/NP_443192.1 (P2-A134) (Accession)

Molecular Weight

Approximately 16 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Ubiquitin Protein Ligase E3 Component N-Recognin 4 (UBR4)
FY-AB46244-01 1 mL

Anti-Ubiquitin Protein Ligase E3 Component N-Recognin 4 (UBR4)

Sign In for Pricing
View Details
Anti-Ubiquitin Protein Ligase E3 Component N-Recognin 4 (UBR4)
FY-AB46244-02 100 µL

Anti-Ubiquitin Protein Ligase E3 Component N-Recognin 4 (UBR4)

Sign In for Pricing
View Details
Anti-Ubiquitin Protein Ligase E3 Component N-Recognin 4 (UBR4)
FY-AB46244-03 200 µL

Anti-Ubiquitin Protein Ligase E3 Component N-Recognin 4 (UBR4)

Sign In for Pricing
View Details
Anti-C4c (Rabbit, Polyclonal)
A109710 100 µL

Anti-C4c (Rabbit, Polyclonal)

Sign In for Pricing
View Details
Gab3 (NM_181584) Mouse Untagged Clone
MC219560 10 µg

Gab3 (NM_181584) Mouse Untagged Clone

Sign In for Pricing
View Details
GFRA4 Antibody (Center) Blocking peptide
MBS9219786-01 0.5 mg

GFRA4 Antibody (Center) Blocking peptide

Sign In for Pricing
View Details