Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBP7, Human (His)

RBP7 protein, a member of the CRBP family, is involved in the stability and metabolism of vitamin A. It binds to all-trans-retinol but with lower affinity compared to other CRBPs. RBP7 protein is expressed in fat, spleen, and other tissues, indicating possible tissue-specific functions. RBP7 Protein, Human (His) is the recombinant human-derived RBP7 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

RBP7 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rbp7-protein-human-his.html

Purity

95.0

Smiles

PADLSGTWTLLSSDNFEGYMLALGIDFATRKIAKLLKPQKVIEQNGDSFTIHTNSSLRNYFVKFKVGEEFDEDNRGLDNRKCKSLVIWDNDRLTCIQKGEKKNRGWTHWIEGDKLHLEMFCEGQVCKQTFQRA

Molecular Formula

116362 (Gene_ID) Q96R05/NP_443192.1 (P2-A134) (Accession)

Molecular Weight

Approximately 16 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

5730446D14Rik Mouse siRNA Oligo Duplex (Locus ID 66640)
SR402450 1 Kit

5730446D14Rik Mouse siRNA Oligo Duplex (Locus ID 66640)

Sign In for Pricing
View Details
FITC*Polyclonal  Goat Anti-Mouse IgG2a
CE30606-01 1 mL

FITC*Polyclonal Goat Anti-Mouse IgG2a

Sign In for Pricing
View Details
FITC*Polyclonal  Goat Anti-Mouse IgG2a
CE30606-02 10 mL

FITC*Polyclonal Goat Anti-Mouse IgG2a

Sign In for Pricing
View Details
HOXB2 (NM_002145) Human Tagged Lenti ORF Clone
RC210396L4 10 µg

HOXB2 (NM_002145) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
GFP hsa-miR-4736 AAV miRNA Vector
Amh1200200 500 ng

GFP hsa-miR-4736 AAV miRNA Vector

Sign In for Pricing
View Details
TRNAQ2 AAV siRNA Pooled Vector
48289161 1.0 µg

TRNAQ2 AAV siRNA Pooled Vector

Sign In for Pricing
View Details