Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBP7, Human (His)

RBP7 protein, a member of the CRBP family, is involved in the stability and metabolism of vitamin A. It binds to all-trans-retinol but with lower affinity compared to other CRBPs. RBP7 protein is expressed in fat, spleen, and other tissues, indicating possible tissue-specific functions. RBP7 Protein, Human (His) is the recombinant human-derived RBP7 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

RBP7 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rbp7-protein-human-his.html

Purity

95.0

Smiles

PADLSGTWTLLSSDNFEGYMLALGIDFATRKIAKLLKPQKVIEQNGDSFTIHTNSSLRNYFVKFKVGEEFDEDNRGLDNRKCKSLVIWDNDRLTCIQKGEKKNRGWTHWIEGDKLHLEMFCEGQVCKQTFQRA

Molecular Formula

116362 (Gene_ID) Q96R05/NP_443192.1 (P2-A134) (Accession)

Molecular Weight

Approximately 16 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cofilin, Phosphorylated (Ser3) (CFL1, CFL, Cofilin-1, 18kD phosphoprotein, Cofilin, non-muscle isoform) (APC)
MBS6287505-01 0.2 mL

Cofilin, Phosphorylated (Ser3) (CFL1, CFL, Cofilin-1, 18kD phosphoprotein, Cofilin, non-muscle isoform) (APC)

Sign In for Pricing
View Details
Cofilin, Phosphorylated (Ser3) (CFL1, CFL, Cofilin-1, 18kD phosphoprotein, Cofilin, non-muscle isoform) (APC)
MBS6287505-02 5x 0.2 mL

Cofilin, Phosphorylated (Ser3) (CFL1, CFL, Cofilin-1, 18kD phosphoprotein, Cofilin, non-muscle isoform) (APC)

Sign In for Pricing
View Details
SLC39A4 AAV Vector (Mouse) (CMV)
44185104 1 µg

SLC39A4 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
Rat Myb-binding protein 1A, MYBBP1A ELISA Kit
MBS9319445-01 48 Well

Rat Myb-binding protein 1A, MYBBP1A ELISA Kit

Sign In for Pricing
View Details
Rat Myb-binding protein 1A, MYBBP1A ELISA Kit
MBS9319445-02 96 Well

Rat Myb-binding protein 1A, MYBBP1A ELISA Kit

Sign In for Pricing
View Details
Rat Myb-binding protein 1A, MYBBP1A ELISA Kit
MBS9319445-03 5x 96 Well

Rat Myb-binding protein 1A, MYBBP1A ELISA Kit

Sign In for Pricing
View Details