Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBP7, Human (His)

RBP7 protein, a member of the CRBP family, is involved in the stability and metabolism of vitamin A. It binds to all-trans-retinol but with lower affinity compared to other CRBPs. RBP7 protein is expressed in fat, spleen, and other tissues, indicating possible tissue-specific functions. RBP7 Protein, Human (His) is the recombinant human-derived RBP7 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

RBP7 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rbp7-protein-human-his.html

Purity

95.0

Smiles

PADLSGTWTLLSSDNFEGYMLALGIDFATRKIAKLLKPQKVIEQNGDSFTIHTNSSLRNYFVKFKVGEEFDEDNRGLDNRKCKSLVIWDNDRLTCIQKGEKKNRGWTHWIEGDKLHLEMFCEGQVCKQTFQRA

Molecular Formula

116362 (Gene_ID) Q96R05/NP_443192.1 (P2-A134) (Accession)

Molecular Weight

Approximately 16 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

M6PR Rabbit Monoclonal Antibody
AF1060 50 µL

M6PR Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Human Calcipressin 1 (RCAN1) (NM_001285393) AAV Particle
RC235745A1V 250 µL

Human Calcipressin 1 (RCAN1) (NM_001285393) AAV Particle

Sign In for Pricing
View Details
Canine FGF-23 ELISA Kit
ECF0016 96 Tests

Canine FGF-23 ELISA Kit

Sign In for Pricing
View Details
Rat Monoclonal ACE-2 Antibody (379131) [DyLight 594]
FAB9334M 0.1 mL

Rat Monoclonal ACE-2 Antibody (379131) [DyLight 594]

Sign In for Pricing
View Details
Cap1 3'UTR GFP Stable Cell Line
TU251624 1.0 mL

Cap1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Mpped2 (NM_001143683) Mouse Untagged Clone
MC211803 10 µg

Mpped2 (NM_001143683) Mouse Untagged Clone

Sign In for Pricing
View Details