Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBP7, Human (His)

RBP7 protein, a member of the CRBP family, is involved in the stability and metabolism of vitamin A. It binds to all-trans-retinol but with lower affinity compared to other CRBPs. RBP7 protein is expressed in fat, spleen, and other tissues, indicating possible tissue-specific functions. RBP7 Protein, Human (His) is the recombinant human-derived RBP7 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

RBP7 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rbp7-protein-human-his.html

Purity

95.0

Smiles

PADLSGTWTLLSSDNFEGYMLALGIDFATRKIAKLLKPQKVIEQNGDSFTIHTNSSLRNYFVKFKVGEEFDEDNRGLDNRKCKSLVIWDNDRLTCIQKGEKKNRGWTHWIEGDKLHLEMFCEGQVCKQTFQRA

Molecular Formula

116362 (Gene_ID) Q96R05/NP_443192.1 (P2-A134) (Accession)

Molecular Weight

Approximately 16 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

14-3-3, sigma (SFN, Stratifin, HGNC:10773) (AP)
MBS6241568-01 0.1 mL

14-3-3, sigma (SFN, Stratifin, HGNC:10773) (AP)

Sign In for Pricing
View Details
14-3-3, sigma (SFN, Stratifin, HGNC:10773) (AP)
MBS6241568-02 5x 0.1 mL

14-3-3, sigma (SFN, Stratifin, HGNC:10773) (AP)

Sign In for Pricing
View Details
P53 (DO-1) B
sc-126 B 200 µg/mL

P53 (DO-1) B

Sign In for Pricing
View Details
MIER1 Recombinant Protein (Human)
RP041335 100 µg

MIER1 Recombinant Protein (Human)

Sign In for Pricing
View Details
APC_Cy7-Linked Monoclonal Antibody to Superoxide Dismutase 3, Extracelular (SOD3)
MBS2151006-01 0.1 mL

APC_Cy7-Linked Monoclonal Antibody to Superoxide Dismutase 3, Extracelular (SOD3)

Sign In for Pricing
View Details
APC_Cy7-Linked Monoclonal Antibody to Superoxide Dismutase 3, Extracelular (SOD3)
MBS2151006-02 0.2 mL

APC_Cy7-Linked Monoclonal Antibody to Superoxide Dismutase 3, Extracelular (SOD3)

Sign In for Pricing
View Details