Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SAE1, Human (GST)

SAE1 protein, forming a heterodimer, acts as an E1 ligase for SUMO1, SUMO2, SUMO3, and potentially SUMO4. It critically mediates ATP-dependent activation of SUMO proteins, enabling the formation of a thioester bond with UBA2/SAE2's active site cysteine. This process is essential for protein modification through sumoylation. SAE1 Protein, Human (GST) is the recombinant human-derived SAE1 protein, expressed by E. coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

SAE1 Protein, Human (GST), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sae1-protein-human-gst.html

Smiles

MVEKEEAGGGISEEEAAQYDRQIRLWGLEAQKRLRASRVLLVGLKGLGAEIAKNLILAGVKGLTMLDHEQVTPEDPGAQFLIRTGSVGRNRAEASLERAQNLNPMVDVKVDTEDIEKKPESFFTQFDAVCLTCCSRDVIVKVDQICHKNSIKFFTGDVFGYHGYTFANLGEHEFVEEKTKVAKVSQGVEDGPDTKRAKLDSSETTMVKKKVVFCPVKEALEVDWSSEKAKAALKRTTSDYFLLQVLLKFRTDKGRDPSSDTYEEDSELLLQIRNDVLDSLGISPDLLPEDFVRYCFSEMAPVCAVVGGILAQEIVKALSQRDPPHNNFFFFDGMKGNGIVECLGPK

Molecular Formula

10055 (Gene_ID) Q9UBE0 (M1-K346) (Accession)

Molecular Weight

Approximately 65.4 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal beta-Actin Antibody (M202)
NBP3-23331 0.1 mL

Mouse Monoclonal beta-Actin Antibody (M202)

Sign In for Pricing
View Details
Anti-HUCE1 Antibody
A30608 100 µL

Anti-HUCE1 Antibody

Sign In for Pricing
View Details
COX6A2 protein, Human, Recombinant (His)
E51P80212 20 µg

COX6A2 protein, Human, Recombinant (His)

Sign In for Pricing
View Details
FABP3 (NM_004102) Human Over-expression Lysate
LY418213 100 µg

FABP3 (NM_004102) Human Over-expression Lysate

Sign In for Pricing
View Details
BAD, phosphorylated (S134) (Bad, Bbc6, Bcl2 antagonist of cell death, Bcl-2-binding component 6, Bcl-xL/Bcl-2-associated death promoter) (APC) discontinued
032398-APC 200 µL

BAD, phosphorylated (S134) (Bad, Bbc6, Bcl2 antagonist of cell death, Bcl-2-binding component 6, Bcl-xL/Bcl-2-associated death promoter) (APC) discontinued

Sign In for Pricing
View Details
2-Iodoanisole
418424-01 10 g

2-Iodoanisole

Sign In for Pricing
View Details