Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SAE1, Human (GST)

SAE1 protein, forming a heterodimer, acts as an E1 ligase for SUMO1, SUMO2, SUMO3, and potentially SUMO4. It critically mediates ATP-dependent activation of SUMO proteins, enabling the formation of a thioester bond with UBA2/SAE2's active site cysteine. This process is essential for protein modification through sumoylation. SAE1 Protein, Human (GST) is the recombinant human-derived SAE1 protein, expressed by E. coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

SAE1 Protein, Human (GST), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sae1-protein-human-gst.html

Smiles

MVEKEEAGGGISEEEAAQYDRQIRLWGLEAQKRLRASRVLLVGLKGLGAEIAKNLILAGVKGLTMLDHEQVTPEDPGAQFLIRTGSVGRNRAEASLERAQNLNPMVDVKVDTEDIEKKPESFFTQFDAVCLTCCSRDVIVKVDQICHKNSIKFFTGDVFGYHGYTFANLGEHEFVEEKTKVAKVSQGVEDGPDTKRAKLDSSETTMVKKKVVFCPVKEALEVDWSSEKAKAALKRTTSDYFLLQVLLKFRTDKGRDPSSDTYEEDSELLLQIRNDVLDSLGISPDLLPEDFVRYCFSEMAPVCAVVGGILAQEIVKALSQRDPPHNNFFFFDGMKGNGIVECLGPK

Molecular Formula

10055 (Gene_ID) Q9UBE0 (M1-K346) (Accession)

Molecular Weight

Approximately 65.4 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TUBA1B Rabbit Monoclonal Antibody
E28G1156 100 µL

TUBA1B Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
LZIC Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV712095 1.0 µg DNA

LZIC Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Vincristine sulfate 10mg
A10973-10 10 mg

Vincristine sulfate 10mg

Sign In for Pricing
View Details
Human F2/Prothrombin ELISA Kit
E0835Hu 96 Tests

Human F2/Prothrombin ELISA Kit

Sign In for Pricing
View Details
HSP90 alpha Mouse Monoclonal Antibody
orb2988326-01 30 µL

HSP90 alpha Mouse Monoclonal Antibody

Sign In for Pricing
View Details
HSP90 alpha Mouse Monoclonal Antibody
orb2988326-02 50 µL

HSP90 alpha Mouse Monoclonal Antibody

Sign In for Pricing
View Details