IL-17F, Cynomolgus (HEK293, His)
IL-17F is an inflammatory homodimeric cytokine that induces many proinflammatory cytokines and chemokines. IL-17F also induces antimicrobial peptides. IL-17F plays a protective role in colon cancer development and can be used for the research of autoimmune diseases, infection and cancer[1][2]. IL-17F Protein, Cynomolgus (HEK293, His) is a recombinant cynomolgus IL-17F protein with His tag at the C-terminus and is expressed in HEK293 cells. It consists of 133 amino acids (R31-Q163) .
Product Specifications
Product Name Alternative
IL-17F Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/il-17f-protein-cynomolgus-hek293-his.html
Smiles
RKIPKVGHTFFQKPESCPPVPEGSMKLDTGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCKHLGCINAQGKEDISMNSVPIQQETLVLRRKHQGCSVSFQLEKVLVTVGCTCVTPVVHHVQ
Molecular Formula
102118959 (Gene_ID) G7P4V0 (R31-Q163) (Accession)
Molecular Weight
Approximately 19-22 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
![Mouse Monoclonal NULP1 Antibody (PCRP-TCF25-1A11) [mFluor Violet 610 SE]](https://cdn.genprice.uk/genprice/uk/genprice3.webp)
Mouse Monoclonal NULP1 Antibody (PCRP-TCF25-1A11) [mFluor Violet 610 SE]
