Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MMP-2, Human (HEK293, His)

MMP-2 protein is a multifunctional metalloproteinase that actively participates in physiological processes such as vascular remodeling, angiogenesis, tissue repair, tumor invasion, inflammation, and atherosclerotic plaque rupture. In addition to degrading extracellular matrix proteins, it also acts on non-matrix proteins to promote vasoconstriction. MMP-2 Protein, Human (HEK293, His) is the recombinant human-derived MMP-2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

MMP-2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mmp-2-protein-human-hek-293-his.html

Purity

98.0

Smiles

APSPIIKFPGDVAPKTDKELAVQYLNTFYGCPKESCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFNGKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNAEGQPCKFPFRFQGTSYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKYESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTYTKNFRLSQDDIKGIQELYGASPDIDLGTGPTPTLGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDPGFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC

Molecular Formula

4313 (Gene_ID) P08253 (A30-C660) (Accession)

Molecular Weight

Approximately 66-72 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zebrafish BMP-2/4 MAb (Clone 169125)
MAB1128-SP 25 µg

Zebrafish BMP-2/4 MAb (Clone 169125)

Sign In for Pricing
View Details
Entpd1 sgRNA CRISPR Lentivector set (Rat)
K7083801 3x 1.0 µg

Entpd1 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
Upf1 (NM_001122829) Mouse Tagged ORF Clone
MR216969 10 µg

Upf1 (NM_001122829) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
GFI1B Rabbit pAb
E47R9881 100 µL

GFI1B Rabbit pAb

Sign In for Pricing
View Details
Rabbit Polyclonal SYPL2 Antibody [DyLight 488]
NBP1-77362G 0.1 mL

Rabbit Polyclonal SYPL2 Antibody [DyLight 488]

Sign In for Pricing
View Details
CDX1 (Homeobox Protein CDX-1, Caudal-type Homeobox Protein 1) (AP) discontinued
124817-AP 100 µL

CDX1 (Homeobox Protein CDX-1, Caudal-type Homeobox Protein 1) (AP) discontinued

Sign In for Pricing
View Details