Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MMP-2, Human (HEK293, His)

MMP-2 protein is a multifunctional metalloproteinase that actively participates in physiological processes such as vascular remodeling, angiogenesis, tissue repair, tumor invasion, inflammation, and atherosclerotic plaque rupture. In addition to degrading extracellular matrix proteins, it also acts on non-matrix proteins to promote vasoconstriction. MMP-2 Protein, Human (HEK293, His) is the recombinant human-derived MMP-2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

MMP-2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mmp-2-protein-human-hek-293-his.html

Purity

98.0

Smiles

APSPIIKFPGDVAPKTDKELAVQYLNTFYGCPKESCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFNGKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNAEGQPCKFPFRFQGTSYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKYESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTYTKNFRLSQDDIKGIQELYGASPDIDLGTGPTPTLGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDPGFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC

Molecular Formula

4313 (Gene_ID) P08253 (A30-C660) (Accession)

Molecular Weight

Approximately 66-72 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

APOL3 Human siRNA Oligo Duplex (Locus ID 80833)
SR312973 1 Kit

APOL3 Human siRNA Oligo Duplex (Locus ID 80833)

Sign In for Pricing
View Details
MBTPS1 (Membrane-bound Transcription Factor Site-1 Protease, Endopeptidase S1P, Subtilisin/Kexin-isozyme 1, SKI-1, MBTPS1, KIAA0091, S1P, SKI1) (APC) discontinued
302547-APC 100 µL

MBTPS1 (Membrane-bound Transcription Factor Site-1 Protease, Endopeptidase S1P, Subtilisin/Kexin-isozyme 1, SKI-1, MBTPS1, KIAA0091, S1P, SKI1) (APC) discontinued

Sign In for Pricing
View Details
DIAPH2, ID (DIAPH2, DIA, Protein diaphanous homolog 2, Diaphanous-related formin-2) (MaxLight 650) discontinued
034640-ML650 100 µL

DIAPH2, ID (DIAPH2, DIA, Protein diaphanous homolog 2, Diaphanous-related formin-2) (MaxLight 650) discontinued

Sign In for Pricing
View Details
SCA29 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV747873 1.0 µg DNA

SCA29 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Rabbit Polyclonal SH3BP4 Antibody [DyLight 650]
NBP1-77031C 0.1 mL

Rabbit Polyclonal SH3BP4 Antibody [DyLight 650]

Sign In for Pricing
View Details
Human recombinant IFN-alpha/beta R2/IFNAR2 protein
PROTP48551-10ug 10 µg

Human recombinant IFN-alpha/beta R2/IFNAR2 protein

Sign In for Pricing
View Details