Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MMP-2, Human (HEK293, His)

MMP-2 protein is a multifunctional metalloproteinase that actively participates in physiological processes such as vascular remodeling, angiogenesis, tissue repair, tumor invasion, inflammation, and atherosclerotic plaque rupture. In addition to degrading extracellular matrix proteins, it also acts on non-matrix proteins to promote vasoconstriction. MMP-2 Protein, Human (HEK293, His) is the recombinant human-derived MMP-2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

MMP-2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mmp-2-protein-human-hek-293-his.html

Purity

98.0

Smiles

APSPIIKFPGDVAPKTDKELAVQYLNTFYGCPKESCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFNGKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNAEGQPCKFPFRFQGTSYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKYESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTYTKNFRLSQDDIKGIQELYGASPDIDLGTGPTPTLGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDPGFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC

Molecular Formula

4313 (Gene_ID) P08253 (A30-C660) (Accession)

Molecular Weight

Approximately 66-72 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

C4ORF51 Protein Vector (Human) (pPB-C-His)
PV066677 500 ng

C4ORF51 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
OR7E83P Protein Vector (Human) (pPB-C-His)
PV108722 500 ng

OR7E83P Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
LOC100365991 3'UTR GFP Stable Cell Line
TU259718 1.0 mL

LOC100365991 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Human ADAMTS15 Knockout HEK293T cell line
GTR15421184 1 Vial

Human ADAMTS15 Knockout HEK293T cell line

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus RNA polymerase sigma factor rpoD (rpoD)
MBS1456182-01 0.02 mg (E-Coli)

Recombinant Staphylococcus aureus RNA polymerase sigma factor rpoD (rpoD)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus RNA polymerase sigma factor rpoD (rpoD)
MBS1456182-02 0.02 mg (Yeast)

Recombinant Staphylococcus aureus RNA polymerase sigma factor rpoD (rpoD)

Sign In for Pricing
View Details