Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MMP-2, Human (HEK293, His)

MMP-2 protein is a multifunctional metalloproteinase that actively participates in physiological processes such as vascular remodeling, angiogenesis, tissue repair, tumor invasion, inflammation, and atherosclerotic plaque rupture. In addition to degrading extracellular matrix proteins, it also acts on non-matrix proteins to promote vasoconstriction. MMP-2 Protein, Human (HEK293, His) is the recombinant human-derived MMP-2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

MMP-2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mmp-2-protein-human-hek-293-his.html

Purity

98.0

Smiles

APSPIIKFPGDVAPKTDKELAVQYLNTFYGCPKESCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFNGKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNAEGQPCKFPFRFQGTSYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKYESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTYTKNFRLSQDDIKGIQELYGASPDIDLGTGPTPTLGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDPGFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC

Molecular Formula

4313 (Gene_ID) P08253 (A30-C660) (Accession)

Molecular Weight

Approximately 66-72 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC35A4 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV695062 1.0 µg DNA

SLC35A4 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
hsa-miR-7161-3p miRNA Mimic
MCH03794 2x 2.5 nmol

hsa-miR-7161-3p miRNA Mimic

Sign In for Pricing
View Details
NFASC Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV699430 1.0 µg DNA

NFASC Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Monkey Growth Differentiation Factor 1 ELISA Kit
MBS010413-01 48 Well

Monkey Growth Differentiation Factor 1 ELISA Kit

Sign In for Pricing
View Details
Monkey Growth Differentiation Factor 1 ELISA Kit
MBS010413-02 96 Well

Monkey Growth Differentiation Factor 1 ELISA Kit

Sign In for Pricing
View Details
Monkey Growth Differentiation Factor 1 ELISA Kit
MBS010413-03 5x 96 Well

Monkey Growth Differentiation Factor 1 ELISA Kit

Sign In for Pricing
View Details