Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MMP-2, Human (HEK293, His)

MMP-2 protein is a multifunctional metalloproteinase that actively participates in physiological processes such as vascular remodeling, angiogenesis, tissue repair, tumor invasion, inflammation, and atherosclerotic plaque rupture. In addition to degrading extracellular matrix proteins, it also acts on non-matrix proteins to promote vasoconstriction. MMP-2 Protein, Human (HEK293, His) is the recombinant human-derived MMP-2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

MMP-2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mmp-2-protein-human-hek-293-his.html

Purity

98.0

Smiles

APSPIIKFPGDVAPKTDKELAVQYLNTFYGCPKESCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFNGKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNAEGQPCKFPFRFQGTSYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKYESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTYTKNFRLSQDDIKGIQELYGASPDIDLGTGPTPTLGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDPGFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC

Molecular Formula

4313 (Gene_ID) P08253 (A30-C660) (Accession)

Molecular Weight

Approximately 66-72 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FHL2 antibody
20R-1089 100 ug

FHL2 antibody

Sign In for Pricing
View Details
NATL/LAB Antibody
3838-100 100 µg

NATL/LAB Antibody

Sign In for Pricing
View Details
ZC3H15 Recombinant Protein Antigen
NBP1-81314PEP 0.1 mL

ZC3H15 Recombinant Protein Antigen

Sign In for Pricing
View Details
1-Methyl-1-propylpyrrolidinium bis (trifluoromethylsulfonyl) imide
IL-0044-HP-0500 500 g

1-Methyl-1-propylpyrrolidinium bis (trifluoromethylsulfonyl) imide

Sign In for Pricing
View Details
Lentiviral human RFXAP shRNA (UAS) - Lentiviral human RFXAP shRNA (UAS, GFP) (100)
GTR15318108 1 Vial

Lentiviral human RFXAP shRNA (UAS) - Lentiviral human RFXAP shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
CALCA Protein Vector (Mouse) (pPB-N-His)
PV161063 500 ng

CALCA Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details