Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MMP-2, Human (HEK293, His)

MMP-2 protein is a multifunctional metalloproteinase that actively participates in physiological processes such as vascular remodeling, angiogenesis, tissue repair, tumor invasion, inflammation, and atherosclerotic plaque rupture. In addition to degrading extracellular matrix proteins, it also acts on non-matrix proteins to promote vasoconstriction. MMP-2 Protein, Human (HEK293, His) is the recombinant human-derived MMP-2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

MMP-2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mmp-2-protein-human-hek-293-his.html

Purity

98.0

Smiles

APSPIIKFPGDVAPKTDKELAVQYLNTFYGCPKESCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFNGKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNAEGQPCKFPFRFQGTSYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKYESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTYTKNFRLSQDDIKGIQELYGASPDIDLGTGPTPTLGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDPGFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC

Molecular Formula

4313 (Gene_ID) P08253 (A30-C660) (Accession)

Molecular Weight

Approximately 66-72 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELA1 (Elastase 1, Pancreatic, PE, CELA1, Chymotrypsin-Like Elastase Family, Member 1)
362950 200 µL

ELA1 (Elastase 1, Pancreatic, PE, CELA1, Chymotrypsin-Like Elastase Family, Member 1)

Sign In for Pricing
View Details
Recombinant Chapare mammarenavirus Pre-glycoprotein polyprotein GP complex (GPC), partial
RPC31622-01 20 µg

Recombinant Chapare mammarenavirus Pre-glycoprotein polyprotein GP complex (GPC), partial

Sign In for Pricing
View Details
Recombinant Chapare mammarenavirus Pre-glycoprotein polyprotein GP complex (GPC), partial
RPC31622-02 100 µg

Recombinant Chapare mammarenavirus Pre-glycoprotein polyprotein GP complex (GPC), partial

Sign In for Pricing
View Details
Recombinant Chapare mammarenavirus Pre-glycoprotein polyprotein GP complex (GPC), partial
RPC31622-03 1 mg

Recombinant Chapare mammarenavirus Pre-glycoprotein polyprotein GP complex (GPC), partial

Sign In for Pricing
View Details
Myoglobin (MB)
130087 100 µg

Myoglobin (MB)

Sign In for Pricing
View Details
RBP4, Recombinant, Rat (Retinol Binding Protein 4)
MBS635505-01 0.01 mg

RBP4, Recombinant, Rat (Retinol Binding Protein 4)

Sign In for Pricing
View Details