Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MMP-2, Human (HEK293, His)

MMP-2 protein is a multifunctional metalloproteinase that actively participates in physiological processes such as vascular remodeling, angiogenesis, tissue repair, tumor invasion, inflammation, and atherosclerotic plaque rupture. In addition to degrading extracellular matrix proteins, it also acts on non-matrix proteins to promote vasoconstriction. MMP-2 Protein, Human (HEK293, His) is the recombinant human-derived MMP-2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

MMP-2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mmp-2-protein-human-hek-293-his.html

Purity

98.0

Smiles

APSPIIKFPGDVAPKTDKELAVQYLNTFYGCPKESCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFNGKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNAEGQPCKFPFRFQGTSYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKYESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTYTKNFRLSQDDIKGIQELYGASPDIDLGTGPTPTLGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDPGFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC

Molecular Formula

4313 (Gene_ID) P08253 (A30-C660) (Accession)

Molecular Weight

Approximately 66-72 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GAL, ID (GAL, GAL1, GALN, GLNN, Galanin peptides, Galanin, Galanin message-associated peptide)
035879 200 µL

GAL, ID (GAL, GAL1, GALN, GLNN, Galanin peptides, Galanin, Galanin message-associated peptide)

Sign In for Pricing
View Details
TRPML Agonist (ML-SA1, 2- (2-Oxo-2- (2,2,4-trimethyl-3,4-dihydroquinolin-1 (2H) -yl) ethyl) isoindoline-1,3-dione, Mucolipin Synthetic Agonist 1)
217851 25 mg

TRPML Agonist (ML-SA1, 2- (2-Oxo-2- (2,2,4-trimethyl-3,4-dihydroquinolin-1 (2H) -yl) ethyl) isoindoline-1,3-dione, Mucolipin Synthetic Agonist 1)

Sign In for Pricing
View Details
Interleukin 15 (IL15) BioAssayTM ELISA Kit (Rabbit) discontinued
026118-01 48 Tests

Interleukin 15 (IL15) BioAssayTM ELISA Kit (Rabbit) discontinued

Sign In for Pricing
View Details
Interleukin 15 (IL15) BioAssayTM ELISA Kit (Rabbit) discontinued
026118-02 96 Tests

Interleukin 15 (IL15) BioAssayTM ELISA Kit (Rabbit) discontinued

Sign In for Pricing
View Details
CHO-K1-CD24 Overexpressing Cell Line
RG-748 5x 10^6

CHO-K1-CD24 Overexpressing Cell Line

Sign In for Pricing
View Details
Rabbit Anti-STK35 antibody
SL12834R-01 50 µL

Rabbit Anti-STK35 antibody

Sign In for Pricing
View Details