Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MMP-2, Human (HEK293, His)

MMP-2 protein is a multifunctional metalloproteinase that actively participates in physiological processes such as vascular remodeling, angiogenesis, tissue repair, tumor invasion, inflammation, and atherosclerotic plaque rupture. In addition to degrading extracellular matrix proteins, it also acts on non-matrix proteins to promote vasoconstriction. MMP-2 Protein, Human (HEK293, His) is the recombinant human-derived MMP-2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

MMP-2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mmp-2-protein-human-hek-293-his.html

Purity

98.0

Smiles

APSPIIKFPGDVAPKTDKELAVQYLNTFYGCPKESCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFNGKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNAEGQPCKFPFRFQGTSYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKYESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTYTKNFRLSQDDIKGIQELYGASPDIDLGTGPTPTLGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDPGFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC

Molecular Formula

4313 (Gene_ID) P08253 (A30-C660) (Accession)

Molecular Weight

Approximately 66-72 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal VLDL R Antibody (6A6) [Alexa Fluor 350]
NBP1-78162AF350 0.1 mL

Mouse Monoclonal VLDL R Antibody (6A6) [Alexa Fluor 350]

Sign In for Pricing
View Details
4933402N03Rik sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3009908 1.0 µg DNA

4933402N03Rik sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Mouse Tgm2 (Transglutaminase 2, Tissue) ELISA Kit
FY-EM3857 96 Well

Mouse Tgm2 (Transglutaminase 2, Tissue) ELISA Kit

Sign In for Pricing
View Details
Nav2 Mouse siRNA Oligo Duplex (Locus ID 78286)
SR423480 1 Kit

Nav2 Mouse siRNA Oligo Duplex (Locus ID 78286)

Sign In for Pricing
View Details
Exportin 5 Recombinant Antibody, AbBy Fluor™ 594 Conjugated
bsm-61945R-BF594-01 20 µL

Exportin 5 Recombinant Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
Exportin 5 Recombinant Antibody, AbBy Fluor™ 594 Conjugated
bsm-61945R-BF594-02 100 µL

Exportin 5 Recombinant Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details