Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MMP-2, Human (HEK293, His)

MMP-2 protein is a multifunctional metalloproteinase that actively participates in physiological processes such as vascular remodeling, angiogenesis, tissue repair, tumor invasion, inflammation, and atherosclerotic plaque rupture. In addition to degrading extracellular matrix proteins, it also acts on non-matrix proteins to promote vasoconstriction. MMP-2 Protein, Human (HEK293, His) is the recombinant human-derived MMP-2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

MMP-2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mmp-2-protein-human-hek-293-his.html

Purity

98.0

Smiles

APSPIIKFPGDVAPKTDKELAVQYLNTFYGCPKESCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFNGKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNAEGQPCKFPFRFQGTSYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKYESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTYTKNFRLSQDDIKGIQELYGASPDIDLGTGPTPTLGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDPGFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC

Molecular Formula

4313 (Gene_ID) P08253 (A30-C660) (Accession)

Molecular Weight

Approximately 66-72 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ENT1 (G-6)
sc-515240 200 µg/mL

ENT1 (G-6)

Sign In for Pricing
View Details
Rat A Disintegrin And Metalloprotease 9 (ADAM9) ELISA Kit
GA-E0368RT-01 48 Tests

Rat A Disintegrin And Metalloprotease 9 (ADAM9) ELISA Kit

Sign In for Pricing
View Details
Rat A Disintegrin And Metalloprotease 9 (ADAM9) ELISA Kit
GA-E0368RT-02 96 Tests

Rat A Disintegrin And Metalloprotease 9 (ADAM9) ELISA Kit

Sign In for Pricing
View Details
FGF13 Protein Vector (Human) (pPM-C-HA)
PV016135 500 ng

FGF13 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
EIF2AK4 ORF Vector (Human) (pORF)
ORF003453 1.0 µg DNA

EIF2AK4 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Porcine Pancreatic Duct Epithelial Cells
AFG-ELL-2229 > 5x 10^5 Cells / Vial

Porcine Pancreatic Duct Epithelial Cells

Sign In for Pricing
View Details