Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MMP-2, Human (HEK293, His)

MMP-2 protein is a multifunctional metalloproteinase that actively participates in physiological processes such as vascular remodeling, angiogenesis, tissue repair, tumor invasion, inflammation, and atherosclerotic plaque rupture. In addition to degrading extracellular matrix proteins, it also acts on non-matrix proteins to promote vasoconstriction. MMP-2 Protein, Human (HEK293, His) is the recombinant human-derived MMP-2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

MMP-2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mmp-2-protein-human-hek-293-his.html

Purity

98.0

Smiles

APSPIIKFPGDVAPKTDKELAVQYLNTFYGCPKESCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFNGKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNAEGQPCKFPFRFQGTSYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKYESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTYTKNFRLSQDDIKGIQELYGASPDIDLGTGPTPTLGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDPGFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC

Molecular Formula

4313 (Gene_ID) P08253 (A30-C660) (Accession)

Molecular Weight

Approximately 66-72 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

KCTD15 (NM_024076) Human Recombinant Protein
TP300838M 100 µg

KCTD15 (NM_024076) Human Recombinant Protein

Sign In for Pricing
View Details
Goat anti-GRM7 Antibody
MBS422024-01 0.1 mg

Goat anti-GRM7 Antibody

Sign In for Pricing
View Details
Goat anti-GRM7 Antibody
MBS422024-02 5x 0.1 mg

Goat anti-GRM7 Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Endometriotic tissue
CS637312 5x 5 µm

Frozen Tissue Sections, Endometriotic tissue

Sign In for Pricing
View Details
TNFSF14 (Tumor Necrosis Factor Ligand Superfamily Member 14, Herpes Virus Entry mediator Ligand, HVEM-L, Herpesvirus Entry mediator Ligand, CD258, Cleaved into the Following 2 Chains, Tumor Necrosis Factor Ligand Superfamily Member 14, Membrane Form) (HRP)
338536-01 50 µg

TNFSF14 (Tumor Necrosis Factor Ligand Superfamily Member 14, Herpes Virus Entry mediator Ligand, HVEM-L, Herpesvirus Entry mediator Ligand, CD258, Cleaved into the Following 2 Chains, Tumor Necrosis Factor Ligand Superfamily Member 14, Membrane Form) (HRP)

Sign In for Pricing
View Details
TNFSF14 (Tumor Necrosis Factor Ligand Superfamily Member 14, Herpes Virus Entry mediator Ligand, HVEM-L, Herpesvirus Entry mediator Ligand, CD258, Cleaved into the Following 2 Chains, Tumor Necrosis Factor Ligand Superfamily Member 14, Membrane Form) (HRP)
338536-02 100 µg

TNFSF14 (Tumor Necrosis Factor Ligand Superfamily Member 14, Herpes Virus Entry mediator Ligand, HVEM-L, Herpesvirus Entry mediator Ligand, CD258, Cleaved into the Following 2 Chains, Tumor Necrosis Factor Ligand Superfamily Member 14, Membrane Form) (HRP)

Sign In for Pricing
View Details