Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MMP-2, Human (HEK293, His)

MMP-2 protein is a multifunctional metalloproteinase that actively participates in physiological processes such as vascular remodeling, angiogenesis, tissue repair, tumor invasion, inflammation, and atherosclerotic plaque rupture. In addition to degrading extracellular matrix proteins, it also acts on non-matrix proteins to promote vasoconstriction. MMP-2 Protein, Human (HEK293, His) is the recombinant human-derived MMP-2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

MMP-2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mmp-2-protein-human-hek-293-his.html

Purity

98.0

Smiles

APSPIIKFPGDVAPKTDKELAVQYLNTFYGCPKESCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFNGKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNAEGQPCKFPFRFQGTSYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKYESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTYTKNFRLSQDDIKGIQELYGASPDIDLGTGPTPTLGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDPGFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC

Molecular Formula

4313 (Gene_ID) P08253 (A30-C660) (Accession)

Molecular Weight

Approximately 66-72 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Tnfsf18 qPCR Primer Pair
QM08642S 200 Tests

Mouse Tnfsf18 qPCR Primer Pair

Sign In for Pricing
View Details
Frozen Tissue Sections, Thyroid gland
CS609662 5x 5 µm

Frozen Tissue Sections, Thyroid gland

Sign In for Pricing
View Details
RUVBL1 (RUVBL1, INO80H, NMP238, TIP49, TIP49A, RuvB-like 1, 49kD TATA box-binding protein-interacting protein, 54kD erythrocyte cytosolic protein, INO80 complex subunit H, Nuclear matrix protein 238, Pontin 52, TIP49a, TIP60-associated protein 54-alpha) (AP) discontinued
031232-AP 200 µL

RUVBL1 (RUVBL1, INO80H, NMP238, TIP49, TIP49A, RuvB-like 1, 49kD TATA box-binding protein-interacting protein, 54kD erythrocyte cytosolic protein, INO80 complex subunit H, Nuclear matrix protein 238, Pontin 52, TIP49a, TIP60-associated protein 54-alpha) (AP) discontinued

Sign In for Pricing
View Details
Human IgE (RC13), mAb, Mouse
V05302-1 1 mg

Human IgE (RC13), mAb, Mouse

Sign In for Pricing
View Details
GNB1 Rabbit Polyclonal Antibody
E53P06869 100 µL

GNB1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Anti-SGOL2 Polyclonal Antibody
MF-0089002-01 50 µL

Anti-SGOL2 Polyclonal Antibody

Sign In for Pricing
View Details