Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MMP-2, Human (HEK293, His)

MMP-2 protein is a multifunctional metalloproteinase that actively participates in physiological processes such as vascular remodeling, angiogenesis, tissue repair, tumor invasion, inflammation, and atherosclerotic plaque rupture. In addition to degrading extracellular matrix proteins, it also acts on non-matrix proteins to promote vasoconstriction. MMP-2 Protein, Human (HEK293, His) is the recombinant human-derived MMP-2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

MMP-2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mmp-2-protein-human-hek-293-his.html

Purity

98.0

Smiles

APSPIIKFPGDVAPKTDKELAVQYLNTFYGCPKESCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFNGKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNAEGQPCKFPFRFQGTSYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKYESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTYTKNFRLSQDDIKGIQELYGASPDIDLGTGPTPTLGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDPGFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC

Molecular Formula

4313 (Gene_ID) P08253 (A30-C660) (Accession)

Molecular Weight

Approximately 66-72 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

C1orf66 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV811592 1.0 µg DNA

C1orf66 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
BDKRB1, ID (B1 Bradykinin Receptor, BK-1 Receptor, B1R, BRADYB1) (PE)
B2675-80A-PE 200 µL

BDKRB1, ID (B1 Bradykinin Receptor, BK-1 Receptor, B1R, BRADYB1) (PE)

Sign In for Pricing
View Details
Stab2 (NM_001246357) Rat Tagged ORF Clone
RR217778 10 µg

Stab2 (NM_001246357) Rat Tagged ORF Clone

Sign In for Pricing
View Details
EPB41 (NM_001166006) Human Tagged ORF Clone
RG229005 10 µg

EPB41 (NM_001166006) Human Tagged ORF Clone

Sign In for Pricing
View Details
TBC1D8B CRISPR/Cas9 KO Plasmid (h)
sc-412369 20 µg

TBC1D8B CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
Rabbit Polyclonal Glycophorin C Antibody [mFluor Violet 610 SE]
NBP2-97085MFV610 0.1 mL

Rabbit Polyclonal Glycophorin C Antibody [mFluor Violet 610 SE]

Sign In for Pricing
View Details