Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MMP-2, Human (HEK293, His)

MMP-2 protein is a multifunctional metalloproteinase that actively participates in physiological processes such as vascular remodeling, angiogenesis, tissue repair, tumor invasion, inflammation, and atherosclerotic plaque rupture. In addition to degrading extracellular matrix proteins, it also acts on non-matrix proteins to promote vasoconstriction. MMP-2 Protein, Human (HEK293, His) is the recombinant human-derived MMP-2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

MMP-2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mmp-2-protein-human-hek-293-his.html

Purity

98.0

Smiles

APSPIIKFPGDVAPKTDKELAVQYLNTFYGCPKESCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFNGKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNAEGQPCKFPFRFQGTSYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKYESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTYTKNFRLSQDDIKGIQELYGASPDIDLGTGPTPTLGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDPGFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC

Molecular Formula

4313 (Gene_ID) P08253 (A30-C660) (Accession)

Molecular Weight

Approximately 66-72 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MIRA Monkeypox Virus Fluorescence Detection Kit
WLDR21089K48 48 Tests/Box

MIRA Monkeypox Virus Fluorescence Detection Kit

Sign In for Pricing
View Details
Rabbit Polyclonal SCAMP4 Antibody [Alexa Fluor 594]
NBP2-81787AF594 0.1 mL

Rabbit Polyclonal SCAMP4 Antibody [Alexa Fluor 594]

Sign In for Pricing
View Details
Human Coxsackie virus IgM, Cox V-IgM ELISA Kit
NSL2411Hu 96 Tests

Human Coxsackie virus IgM, Cox V-IgM ELISA Kit

Sign In for Pricing
View Details
DDX19B, NT (DDX19B, DBP5, DDX19, TDBP, ATP-dependent RNA helicase DDX19B, DEAD box RNA helicase DEAD5, DEAD box protein 19B) (PE) discontinued
034546-PE 200 µL

DDX19B, NT (DDX19B, DBP5, DDX19, TDBP, ATP-dependent RNA helicase DDX19B, DEAD box RNA helicase DEAD5, DEAD box protein 19B) (PE) discontinued

Sign In for Pricing
View Details
Rcan1 sgRNA CRISPR Lentivector (Rat) (Target 1)
K6674102 1.0 µg DNA

Rcan1 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Fads1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K4855505 3x 1.0 µg

Fads1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details