Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MMP-2, Human (HEK293, His)

MMP-2 protein is a multifunctional metalloproteinase that actively participates in physiological processes such as vascular remodeling, angiogenesis, tissue repair, tumor invasion, inflammation, and atherosclerotic plaque rupture. In addition to degrading extracellular matrix proteins, it also acts on non-matrix proteins to promote vasoconstriction. MMP-2 Protein, Human (HEK293, His) is the recombinant human-derived MMP-2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

MMP-2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mmp-2-protein-human-hek-293-his.html

Purity

98.0

Smiles

APSPIIKFPGDVAPKTDKELAVQYLNTFYGCPKESCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFNGKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNAEGQPCKFPFRFQGTSYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKYESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTYTKNFRLSQDDIKGIQELYGASPDIDLGTGPTPTLGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDPGFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC

Molecular Formula

4313 (Gene_ID) P08253 (A30-C660) (Accession)

Molecular Weight

Approximately 66-72 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Oryza sativa subsp. japonica (Rice) Os03g0210000 Polyclonal Antibody
MBS7189020 Inquire

Rabbit anti-Oryza sativa subsp. japonica (Rice) Os03g0210000 Polyclonal Antibody

Sign In for Pricing
View Details
Matrix Metalloproteinase 9 (Matrix Metallopeptidase 9, MMP-9, MMP9, 92kD Gelatinase, 92kD Type IV Collagenase, CLG4B, Gelatinase B, GELB, MANDP2) (MaxLight 405) discontinued
M2425-01G-ML405 100 µL

Matrix Metalloproteinase 9 (Matrix Metallopeptidase 9, MMP-9, MMP9, 92kD Gelatinase, 92kD Type IV Collagenase, CLG4B, Gelatinase B, GELB, MANDP2) (MaxLight 405) discontinued

Sign In for Pricing
View Details
CD161 Antibody
C30502-01 50 μL

CD161 Antibody

Sign In for Pricing
View Details
CD161 Antibody
C30502-02 100 µL

CD161 Antibody

Sign In for Pricing
View Details
Lentiviral human NUP50 shRNA (UAS) - Lentiviral human NUP50 shRNA (UAS, GFP) (100)
GTR15334392 1 Vial

Lentiviral human NUP50 shRNA (UAS) - Lentiviral human NUP50 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Human KRR1 small subunit processome component homolog, KRR1 ELISA Kit
MBS9316855-01 48 Well

Human KRR1 small subunit processome component homolog, KRR1 ELISA Kit

Sign In for Pricing
View Details