Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MMP-2, Human (HEK293, His)

MMP-2 protein is a multifunctional metalloproteinase that actively participates in physiological processes such as vascular remodeling, angiogenesis, tissue repair, tumor invasion, inflammation, and atherosclerotic plaque rupture. In addition to degrading extracellular matrix proteins, it also acts on non-matrix proteins to promote vasoconstriction. MMP-2 Protein, Human (HEK293, His) is the recombinant human-derived MMP-2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

MMP-2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mmp-2-protein-human-hek-293-his.html

Purity

98.0

Smiles

APSPIIKFPGDVAPKTDKELAVQYLNTFYGCPKESCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFNGKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNAEGQPCKFPFRFQGTSYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKYESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTYTKNFRLSQDDIKGIQELYGASPDIDLGTGPTPTLGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDPGFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC

Molecular Formula

4313 (Gene_ID) P08253 (A30-C660) (Accession)

Molecular Weight

Approximately 66-72 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ssrp1 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4790903 1.0 µg DNA

Ssrp1 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
PPP1R8 Protein Vector (Rat) (pPB-N-His)
PV295711 500 ng

PPP1R8 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
UCHL1 (Ubiquitin carboxyl-terminal Esterase L1 (Ubiquitin thiolEsterase), PARK5, PGP9.5, Uch-L1) (APC)
MBS6168276-01 0.1 mL

UCHL1 (Ubiquitin carboxyl-terminal Esterase L1 (Ubiquitin thiolEsterase), PARK5, PGP9.5, Uch-L1) (APC)

Sign In for Pricing
View Details
UCHL1 (Ubiquitin carboxyl-terminal Esterase L1 (Ubiquitin thiolEsterase), PARK5, PGP9.5, Uch-L1) (APC)
MBS6168276-02 5x 0.1 mL

UCHL1 (Ubiquitin carboxyl-terminal Esterase L1 (Ubiquitin thiolEsterase), PARK5, PGP9.5, Uch-L1) (APC)

Sign In for Pricing
View Details
FITC Anti-Human CD4 Antibody[SK3]
RD30731F-01 20 Tests

FITC Anti-Human CD4 Antibody[SK3]

Sign In for Pricing
View Details
FITC Anti-Human CD4 Antibody[SK3]
RD30731F-02 100 Tests

FITC Anti-Human CD4 Antibody[SK3]

Sign In for Pricing
View Details