Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MMP-2, Human (HEK293, His)

MMP-2 protein is a multifunctional metalloproteinase that actively participates in physiological processes such as vascular remodeling, angiogenesis, tissue repair, tumor invasion, inflammation, and atherosclerotic plaque rupture. In addition to degrading extracellular matrix proteins, it also acts on non-matrix proteins to promote vasoconstriction. MMP-2 Protein, Human (HEK293, His) is the recombinant human-derived MMP-2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

MMP-2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mmp-2-protein-human-hek-293-his.html

Purity

98.0

Smiles

APSPIIKFPGDVAPKTDKELAVQYLNTFYGCPKESCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFNGKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNAEGQPCKFPFRFQGTSYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKYESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTYTKNFRLSQDDIKGIQELYGASPDIDLGTGPTPTLGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDPGFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC

Molecular Formula

4313 (Gene_ID) P08253 (A30-C660) (Accession)

Molecular Weight

Approximately 66-72 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TDG Knockout HEK293T cell line
GTR15416943 1 Vial

Human TDG Knockout HEK293T cell line

Sign In for Pricing
View Details
SERINC2 discontinued
514077 100 µg

SERINC2 discontinued

Sign In for Pricing
View Details
RPL39P40 sgRNA CRISPR Lentivector (Human) (Target 2)
K1993703 1.0 µg DNA

RPL39P40 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
GBA3 Mouse Monoclonal Antibody [Clone ID: OTI4C7]
CF502603 100 µg

GBA3 Mouse Monoclonal Antibody [Clone ID: OTI4C7]

Sign In for Pricing
View Details
Recombinant Vanderwaltozyma polyspora Regulator of free ubiquitin chains 1 (RFU1)
MBS1214712-01 0.02 mg (E-Coli)

Recombinant Vanderwaltozyma polyspora Regulator of free ubiquitin chains 1 (RFU1)

Sign In for Pricing
View Details
Recombinant Vanderwaltozyma polyspora Regulator of free ubiquitin chains 1 (RFU1)
MBS1214712-02 0.1 mg (E-Coli)

Recombinant Vanderwaltozyma polyspora Regulator of free ubiquitin chains 1 (RFU1)

Sign In for Pricing
View Details