Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MMP-2, Human (HEK293, His)

MMP-2 protein is a multifunctional metalloproteinase that actively participates in physiological processes such as vascular remodeling, angiogenesis, tissue repair, tumor invasion, inflammation, and atherosclerotic plaque rupture. In addition to degrading extracellular matrix proteins, it also acts on non-matrix proteins to promote vasoconstriction. MMP-2 Protein, Human (HEK293, His) is the recombinant human-derived MMP-2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

MMP-2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mmp-2-protein-human-hek-293-his.html

Purity

98.0

Smiles

APSPIIKFPGDVAPKTDKELAVQYLNTFYGCPKESCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFNGKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNAEGQPCKFPFRFQGTSYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKYESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTYTKNFRLSQDDIKGIQELYGASPDIDLGTGPTPTLGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDPGFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC

Molecular Formula

4313 (Gene_ID) P08253 (A30-C660) (Accession)

Molecular Weight

Approximately 66-72 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

OAT Protein Vector (Human) (pPM-C-His)
PV029352 500 ng

OAT Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Recombinant Macaque IL-3/ Interleukin-3 Protein, Untagged, E.coli-250ug
QP10336-ec-250ug 250ug

Recombinant Macaque IL-3/ Interleukin-3 Protein, Untagged, E.coli-250ug

Sign In for Pricing
View Details
Etv1 (NM_001163154) Mouse Tagged ORF Clone Lentiviral Particle
MR226743L3V 200 µL

Etv1 (NM_001163154) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Human MTSS1 Pre-designed siRNA Set B
SI010026B 1 Each

Human MTSS1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Mouse Protein NipSnap homolog 3A, NIPSNAP3A ELISA Kit
MBS9320312-01 48 Well

Mouse Protein NipSnap homolog 3A, NIPSNAP3A ELISA Kit

Sign In for Pricing
View Details
Mouse Protein NipSnap homolog 3A, NIPSNAP3A ELISA Kit
MBS9320312-02 96 Well

Mouse Protein NipSnap homolog 3A, NIPSNAP3A ELISA Kit

Sign In for Pricing
View Details