Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Small proline-rich protein 2E (Sprr2e)

Product Specifications

Abbreviation

Recombinant Mouse Sprr2e protein

Gene Name

Sprr2e

UniProt

O70556

Expression Region

1-76aa

Organism

Mus musculus (Mouse)

Target Sequence

MSYQQQQCKQPCQPPPVCPPKKCPEPCPHPQCPEPCPPPKCPEPCPEPCPPPSYQQKCPPVQPPPPCQQKCPPKSK

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Others

Relevance

Cross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase. All that results in the formation of an insoluble envelope beneath the plasma membrane.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

9.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Neurofilament (NF-L) (NFL/736), CF647 conjugate, 0.1mg/mL
BNC470736-500 1x 500 µL

Neurofilament (NF-L) (NFL/736), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS633576 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
Ki67 (MKI67) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI8H5]
TA800648AM 100 µL

Ki67 (MKI67) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI8H5]

Sign In for Pricing
View Details
ACBD4 (NM_001135707) Human Over-expression Lysate
LY427681 100 µg

ACBD4 (NM_001135707) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS708477 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
Benzotropine Mesylate
TRC-B207575-50MG 50 mg

Benzotropine Mesylate

Sign In for Pricing
View Details