Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-6R, Rhesus Macaque (HEK293, His)

IL-6R alpha is a subunit alpha of IL-6 receptors, also shared by other interleukin receptors. IL-6R alpha acts as IL-6 agonist and involves in JAK/STAT, MAPK, and Akt signaling pathway[1][2]. IL-6R alpha, Rhesus Macaque consists of 365 amino acids (M1-P365) and is produced in HEK293 cells with a C-Terminal His-tag.

Product Specifications

Product Name Alternative

IL-6R Protein, Rhesus Macaque (HEK293, His), Rhesus Macaque, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-6r-protein-rhesus-macaque-hek293-his.html

Purity

96.90

Smiles

LAPGGCPAQEVARGVLTSLPGDSVTLTCPGGEPEDNATVHWVLRKPAVGSHLSRWAGVGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSPTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKLSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPTQAPTTNKDDDNILSRDSANATSLPVQDSSSVPLP

Molecular Formula

716690 (Gene_ID) XP_001114404.1 (L20-P365) (Accession)

Molecular Weight

Approximately 60-70 kDa

References & Citations

[1]Garbers C, et al. Inhibition of classic signaling is a novel function of soluble glycoprotein 130 (sgp130), which is controlled by the ratio of interleukin 6 and soluble interleukin 6 receptor. J Biol Chem. 2011 Dec 16;286 (50) :42959-70.|[2]Malemud, et al. Defective JAK-STAT Pathway Signaling Contributes to Autoimmune Diseases. Curr Pharmacol Rep 4, 358-366.|[3]Larsen JV, et al. SorLA in Interleukin-6 Signaling and Turnover. Mol Cell Biol. 2017 May 16;37 (11) :e00641-16.|[4]Kang S, et al. Targeting Interleukin-6 Signaling in Clinic. Immunity. 2019 Apr 16;50 (4) :1007-1023.|[5]Giannitrapani L, et al. Circulating IL-6 and sIL-6R in patients with hepatocellular carcinoma. Ann N Y Acad Sci. 2002 Jun;963:46-52.|[6]Arnold P, et al. Joint Reconstituted Signaling of the IL-6 Receptor via Extracellular Vesicles. Cells. 2020 May 24;9 (5) :1307.|[7]Mishra AK, et al. Metformin inhibits IL-6 signaling by decreasing IL-6R expression on multiple myeloma cells. Leukemia. 2019 Nov;33 (11) :2695-2709.|[8]Gruber CN, et al. Mapping Systemic Inflammation and Antibody Responses in Multisystem Inflammatory Syndrome in Children (MIS-C) . Cell. 2020 Nov 12;183 (4) :982-995.e14.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Hapalemur griseus Melanocyte-stimulating hormone receptor (MC1R), partial
MBS7091634 Inquire

Recombinant Hapalemur griseus Melanocyte-stimulating hormone receptor (MC1R), partial

Sign In for Pricing
View Details
Atp6v0b sgRNA CRISPR Lentivector set (Mouse)
K3467901 3x 1.0 µg

Atp6v0b sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Tomentosin
AB3375 5 mg

Tomentosin

Sign In for Pricing
View Details
CCT239065-d7
TRC-C227952-100MG 100 mg

CCT239065-d7

Sign In for Pricing
View Details
Klhl18 Mouse Gene Knockout Kit (CRISPR)
KN508857 1 Kit

Klhl18 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Nat15 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4575803 1.0 µg DNA

Nat15 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details