Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-6R, Rhesus Macaque (HEK293, His)

IL-6R alpha is a subunit alpha of IL-6 receptors, also shared by other interleukin receptors. IL-6R alpha acts as IL-6 agonist and involves in JAK/STAT, MAPK, and Akt signaling pathway[1][2]. IL-6R alpha, Rhesus Macaque consists of 365 amino acids (M1-P365) and is produced in HEK293 cells with a C-Terminal His-tag.

Product Specifications

Product Name Alternative

IL-6R Protein, Rhesus Macaque (HEK293, His), Rhesus Macaque, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-6r-protein-rhesus-macaque-hek293-his.html

Purity

96.90

Smiles

LAPGGCPAQEVARGVLTSLPGDSVTLTCPGGEPEDNATVHWVLRKPAVGSHLSRWAGVGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSPTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKLSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPTQAPTTNKDDDNILSRDSANATSLPVQDSSSVPLP

Molecular Formula

716690 (Gene_ID) XP_001114404.1 (L20-P365) (Accession)

Molecular Weight

Approximately 60-70 kDa

References & Citations

[1]Garbers C, et al. Inhibition of classic signaling is a novel function of soluble glycoprotein 130 (sgp130), which is controlled by the ratio of interleukin 6 and soluble interleukin 6 receptor. J Biol Chem. 2011 Dec 16;286 (50) :42959-70.|[2]Malemud, et al. Defective JAK-STAT Pathway Signaling Contributes to Autoimmune Diseases. Curr Pharmacol Rep 4, 358-366.|[3]Larsen JV, et al. SorLA in Interleukin-6 Signaling and Turnover. Mol Cell Biol. 2017 May 16;37 (11) :e00641-16.|[4]Kang S, et al. Targeting Interleukin-6 Signaling in Clinic. Immunity. 2019 Apr 16;50 (4) :1007-1023.|[5]Giannitrapani L, et al. Circulating IL-6 and sIL-6R in patients with hepatocellular carcinoma. Ann N Y Acad Sci. 2002 Jun;963:46-52.|[6]Arnold P, et al. Joint Reconstituted Signaling of the IL-6 Receptor via Extracellular Vesicles. Cells. 2020 May 24;9 (5) :1307.|[7]Mishra AK, et al. Metformin inhibits IL-6 signaling by decreasing IL-6R expression on multiple myeloma cells. Leukemia. 2019 Nov;33 (11) :2695-2709.|[8]Gruber CN, et al. Mapping Systemic Inflammation and Antibody Responses in Multisystem Inflammatory Syndrome in Children (MIS-C) . Cell. 2020 Nov 12;183 (4) :982-995.e14.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SUOX Antibody - middle region
MBS3221844-01 0.1 mL

SUOX Antibody - middle region

Sign In for Pricing
View Details
SUOX Antibody - middle region
MBS3221844-02 5x 0.1 mL

SUOX Antibody - middle region

Sign In for Pricing
View Details
APC/Cyanine7 Mouse IgG1, κ Isotype Ctrl
GT16929 100 Tests

APC/Cyanine7 Mouse IgG1, κ Isotype Ctrl

Sign In for Pricing
View Details
Dnmt3b (NM_001122997) Mouse Untagged Clone
MC222141 10 µg

Dnmt3b (NM_001122997) Mouse Untagged Clone

Sign In for Pricing
View Details
Recombinant Rat CLRN3 Protein, His (Fc)-Avi-tagged
CLRN3-1123R 50 µg

Recombinant Rat CLRN3 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
RPL35 Recombinant Protein Antigen
NBP1-81330PEP 0.1 mL

RPL35 Recombinant Protein Antigen

Sign In for Pricing
View Details